KEGG   Nautilia profundicola: NAMH_0898Help
Entry
NAMH_0898         CDS       T00860                                 

Gene name
glyA
Definition
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
nam  Nautilia profundicola
Pathway
nam00260  Glycine, serine and threonine metabolism
nam00630  Glyoxylate and dicarboxylate metabolism
nam00670  One carbon pool by folate
nam00680  Methane metabolism
nam01100  Metabolic pathways
nam01110  Biosynthesis of secondary metabolites
nam01120  Microbial metabolism in diverse environments
nam01130  Biosynthesis of antibiotics
nam01200  Carbon metabolism
nam01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NAMH_0898 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    NAMH_0898 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAMH_0898 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    NAMH_0898 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NAMH_0898 (glyA)
Enzymes [BR:nam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     NAMH_0898 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACM92361
UniProt: B9L9J3
Position
823691..824938
Genome map
AA seq 415 aa AA seqDB search
MSLRDYDIDVYSIIEKELERQTNHLEMIASENFTLPEVMEAMGSVFTNKYAEGYPYKRYY
GGCEYADLVEQLAIDRAKELFGCEFANVQPHSGSQANGAVYVALLKPLDKLLGMDLSNGG
HLTHGAKVNFSGKHYHSFSYGIDEKTGRIDYDRVRDIAKITKPKMIVCGASAYPREIDFA
KFREIADEVGAILMADVAHIAGLVVAGEHPHPFPHCDVVTTTTHKTLRGPRGGLILTNNE
EYAKKINSAIFPGIQGGPLVHVIAAKAVGFKMNLQPSWKEYAKQVKANAKVLAEVLLERG
YDIVSGGTDNHLVLVSFLNKEFSGKEAEEALGRAGITVNKNTVPGEKRSPFVTSGIRIGS
PALTARGMKEEEFRLIATRIADVLDDIYNLELQDKVAAELKELASKFVIYDRPTY
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaagagattacgatattgacgtttattcaataattgaaaaagaacttgaaaga
caaacaaaccacctcgaaatgattgcaagtgaaaacttcactcttcctgaagttatggaa
gctatggggagtgtatttacaaataaatatgctgaaggttatccgtacaaaagatattac
ggtggatgtgaatacgccgacttagttgaacagttggcaattgacagggcaaaagagctt
ttcggatgtgagtttgcaaacgttcagccgcattctggaagccaggcaaacggtgccgta
tatgttgcacttttaaaacctcttgataaactacttggaatggatctaagcaatggagga
cacttaactcacggtgctaaggttaacttctcaggtaaacattatcacagtttctcttac
ggaattgatgaaaaaaccggaagaatcgattacgacagagtaagagatatcgcaaaaatc
actaaacctaaaatgatcgtttgcggtgcgagtgcatacccgagagagattgatttcgct
aaatttagagaaatcgctgatgaagtgggtgctattttaatggctgacgtagcacatatt
gctggtcttgtggttgcaggtgagcatcctcatccgttccctcactgtgatgttgtgaca
actacgactcataaaacattaagaggaccaagaggcgggcttatccttacaaacaacgag
gaatacgctaaaaaaatcaacagtgctattttccctggaattcagggtggtccattagta
cacgtaatcgcagctaaagctgtaggatttaaaatgaaccttcagccgagctggaaagaa
tacgcaaaacaggtaaaagctaacgctaaagtacttgctgaagtactgcttgagagaggt
tatgatatcgttagtggtggtactgacaatcatttagtacttgtaagtttcttaaataaa
gaattcagtggtaaagaagctgaagaagcgcttggaagagccggaattactgtaaataaa
aacacagtacctggtgaaaaaagaagtccttttgtaacttcaggtatcagaatcggaagc
ccggcacttactgcaagaggaatgaaagaagaagaattcagattgattgctacaagaatt
gcagacgttcttgatgatatttataatcttgaattacaagataaagtagcggctgagctt
aaagaacttgcaagcaaattcgtaatttacgacagacctacatattaa

DBGET integrated database retrieval system