KEGG   Natronolimnobius sulfurireducens AArc1: AArc1_1188Help
Entry
AArc1_1188        CDS       T05614                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
nan  Natronolimnobius sulfurireducens AArc1
Pathway
nan00564  Glycerophospholipid metabolism
nan01100  Metabolic pathways
nan01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AArc1_1188
Enzymes [BR:nan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     AArc1_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AXR77528
UniProt: A0A346PDD3
Position
1179894..1180712
Genome map
AA seq 272 aa AA seqDB search
MNFAPGAWKYAIVPLLAAPFAVIYSVAAGLLSLALGVGALAFFRDPERTPPPTGVVSPAD
GTVSVLREEGDQVRLGVFMNVWHVHVVRAPFDATVVDVEHVSGAHRPAFSKESEKNERVH
VSLETDSLTSQSAETALEADGDTDDELDGSNEDRFDGPNDDGAIEPAEVTFIAGAFARRI
FPYVEPGDELERGDRIGHIAFGSRVDLCFPPSIDRDEVAVEPGESTTAGETVVLETPADV
GPFDTPIGGFDFDTQSDGSGADETDDPASSPS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgcgccgggagcctggaagtacgctatcgttccgctgctcgcagcgccgttt
gcagtcatctacagcgtcgctgcgggcctcctctcgctcgcactcggcgtcggtgcgctc
gcgttctttcgcgatccagagcggacgccgccgccgacaggcgtcgtctcaccggctgac
ggcaccgtttcggtgttgcgtgaggaaggcgatcaggtccgactcggcgtgttcatgaac
gtctggcacgtccacgtcgtccgcgcgccgttcgatgcgaccgtcgtcgacgtcgaacac
gtctcgggagcccaccgtcccgccttctccaaggaatcggagaaaaacgagcgcgtccac
gtcagcctcgagactgactcgttgacatcccagtcggccgagacggcgctcgaggcggac
ggcgacacggacgacgagttagacggctcgaacgaggacagattcgacggtccaaacgat
gacggggcgatcgaacctgccgaagtgacgttcatcgcgggcgcgttcgcccgtcggatc
ttcccctacgtcgagcccggcgacgaactcgagcgcggtgaccgcatcggtcacatcgcc
ttcggtagccgggtcgatctctgctttccgccctcgatcgatcgtgacgaggtcgccgtc
gagcctggcgagtcgacgaccgccggggagacggtcgtcctcgagacaccagcggacgtc
gggccgttcgacacgccgatcggcgggttcgacttcgacacacagtcggacgggtcgggg
gcggacgagaccgacgacccggcctcgagcccgtcctga

DBGET integrated database retrieval system