KEGG   Natronolimnobius sulfurireducens AArc1: AArc1_2332Help
Entry
AArc1_2332        CDS       T05614                                 

Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
nan  Natronolimnobius sulfurireducens AArc1
Pathway
nan00860  Porphyrin and chlorophyll metabolism
nan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AArc1_2332
Enzymes [BR:nan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AArc1_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO DJ-1_PfpI GATase NTPase_1 CTP_synth_N
Motif
Other DBs
NCBI-ProteinID: AXR78647
UniProt: A0A346PGK2
Position
2315090..2316703
Genome map
AA seq 537 aa AA seqDB search
MTRTLLVAGTASHVGKSTIAAGLCRLLADRGVSVAPFKAQNMSNNARVVLRPDADLDDTA
HEAEPGGGDRWGEIGVSQFVQARAARMTPTTDCNPVLLKPRGDGESQLVLGGRAVDHFTA
GTYYESHWKRARTAAKDSFDRLAADHDVVVAEGAGSIGEINLHDRDLANVETAQFADADV
LLLVDIERGGAFASLYGTIELVPDDLRDRIVGALITKFRGDPSLLEPGIEEIESRTGVPI
LGVVPYADPGLPEEDSVGLPGAEERGVHGGDDGVPDDRRLRIGVPRLPRISNATDLEALA
SEPGVSVIYLPVDPDSPVDERALADVDAVVLPGTKNTVDDLLALRAAGFADALYAFDGPV
VGLCGGYQLLGERITNAALEGTGTDDVVEGLGLLPVETRFEPDKRLEQTTVSIDGSATPI
LEGATGTASGYEIHAGRTRPLSDADVRQPLGDSSAACGRVLGTYLHGLFDNDSVRGAFLD
SVAATAGVDRPRPSEFSGTDNDSASGSASLVGATPYDRAATLVRAHVDLESLGEPFV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgactcggacccttctcgtcgccggaaccgcgagtcacgtcggtaaatcgaccatcgcc
gcggggctctgtcggctgctcgcagaccgtggcgtctcagtcgccccgtttaaggcccag
aacatgagcaacaacgcgcgcgttgttctccggcctgacgccgacctcgacgacacagca
cacgaggcagagccgggcggcggtgaccgctggggcgagatcggcgtctcgcagttcgtc
caggctcgagcggcccgcatgacgccgacgactgactgtaaccccgtattgctcaagccc
cgtggcgacggcgagagccaactcgtcttgggtggccgtgccgtcgatcatttcaccgcg
ggaacctattacgagtctcactggaagcgagcgcgtacggccgccaaagattcgttcgac
cggctcgcagccgaccacgacgtcgtcgtcgccgaaggcgcggggagcatcggtgagatc
aacctccacgatcgggatctggcgaacgtcgagacggctcagtttgccgacgccgacgtc
ctcctgctcgtcgacatcgagcgcggcggcgcgttcgcgagcctctacggaacgatcgaa
ctcgttcccgacgacctgcgcgaccggatcgtcggcgcgctcatcaccaagttccgcggc
gatccgtcactgctcgagccaggcatcgaggagatcgaatcccggacgggtgttccgatt
ctcggtgtagttccgtacgccgaccccggattgcccgaagaggacagcgtcgggctccca
ggggcggaagaacgcggcgtccacggcggtgacgacggcgtccccgacgaccgtcgactg
cggattggcgttcctcgtctcccccgaatctcgaacgccaccgatctcgaggcgctggcg
agcgaacccggcgtctcggtgatctatctcccggtcgatcccgactcgccagtggacgaa
cgcgcgctcgcggacgtcgacgccgtcgtgcttccggggacgaagaacacggtcgacgac
ctgttggcgctccgggcggccggcttcgccgacgcactctacgcgttcgacggccccgtg
gtcggcctctgtggcggctaccagctcctcggcgaacggatcaccaacgccgcactcgag
gggacgggcaccgacgacgtcgtcgagggactcggcctgctcccggtcgaaacgcggttc
gaacccgacaagcgactcgagcagaccacagtgtcgatagacgggagcgcgacgccgatt
ctcgagggggcgactgggactgcttcaggctacgagatccacgctggccggacccgaccg
ctgtccgatgccgacgttcgtcagccgctcggcgactcgagcgctgcctgcggccgggtg
cttggaacctacctccacggtctgttcgacaacgactccgtccgcggggcgtttctcgac
agcgtcgcagcgacagcgggcgtcgaccgaccgcgtccgagtgagttctccggcaccgac
aatgactctgcatcgggttcggcgtctctcgtcggcgcaacgccgtacgaccgcgccgca
acgctggtccgagcgcacgtcgacctcgagagtctcggcgagccgttcgtctga

DBGET integrated database retrieval system