KEGG   Natronolimnobius sulfurireducens AArc1: AArc1_2628Help
Entry
AArc1_2628        CDS       T05614                                 

Definition
(GenBank) Pterin-4a-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nan  Natronolimnobius sulfurireducens AArc1
Pathway
nan00790  Folate biosynthesis
nan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AArc1_2628
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nan04147]
    AArc1_2628
Enzymes [BR:nan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AArc1_2628
Exosome [BR:nan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AArc1_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AXR78941
UniProt: A0A346PHE6
Position
2637205..2637552
Genome map
AA seq 115 aa AA seqDB search
MALADQECEACTSEDEPLTEPEYADYLGELEDDVWAVVDDHHLEGAYEFPDFRNALEFTY
EVGELAEEEWHHPDIHLQWGEVRIEVWTHKIDGLHESDFVMAAKMDRCYEEYPEE
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgccgatcaggagtgtgaagcctgtacgtccgaggacgaaccgctcaccgag
ccggagtacgcggactacctcggggaactcgaggacgacgtctgggcggtcgttgacgac
caccatctcgagggagcctacgagttcccggacttccgcaacgcgctcgagttcacctac
gaggtcggcgaactcgccgaagaggagtggcaccacccggacatccacctccagtggggc
gaagtccggatcgaggtgtggacacacaagatcgacggcttacacgagtcggatttcgtc
atggccgcgaagatggaccggtgctacgaggagtatcccgaggagtga

DBGET integrated database retrieval system