KEGG   Nitrospirillum amazonense: Y958_04195Help
Entry
Y958_04195        CDS       T04935                                 

Definition
(GenBank) bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00250  Alanine, aspartate and glutamate metabolism
nao00330  Arginine and proline metabolism
nao01100  Metabolic pathways
nao01110  Biosynthesis of secondary metabolites
nao01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y958_04195
   00330 Arginine and proline metabolism
    Y958_04195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nao03000]
    Y958_04195
Enzymes [BR:nao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Y958_04195
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     Y958_04195
Transcription factors [BR:nao03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    Y958_04195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ASG20115
UniProt: A0A248JN23
Position
1:895848..899018
Genome map
AA seq 1056 aa AA seqDB search
MYQATAPSSSPSPATPDLDGPRAALRRAKHLNEETAVRALLAAHGLTAEERRAIDAQAVD
VVNAARARRSELGPLDAFMQEFGLSNQEGIALMCIAECLLRIADPATADRLIAEKIMKGQ
WDQHLGQSDSAFVNAAAWGLMLTGRVVEVDTKKQGDAPGLLRRLVQRSGEPVIRAAMMKA
MRVMGEHFVMGRTIAEAVAEAKKAKPEGTVHSYDMLGEGARTWEQADRYQASYLNAIDTV
GKAAAGRGPYAAPGVSIKLSALHPRYVFAKRADVMAQLLPRVKDLCLAAKRWDINLTIDA
EEADRLDISLDLLEALARDGDLAGWNGLGLAIQAYQKRTAHLVDWLAALARSAGRRLMVR
LVKGAYWDTEIKFSQTQGHADYPVYTKKAATDLSYLVCARRMLAAKDAIYPQFATHNAYT
IAAILHLAGDNRDLEFQRLHGMGDLLYAAARDRLKDVPRVRIYAPVGTHEDLLPYLVRRL
LENGANSNFVNAYMDPAIPVSQVVADPIALLEALPVLRHAGIPTPDKLYGDDRANSRGVD
LTDEATVRSLRAGIDAALAQAWTAGPIVGGQDLAGQKARPVLDPSDHTRTVGTTADATAE
HIDRALALAAQAQPGWDALGGEGRARILDAMGDALEADTPALLGILIREAGKTWGDAVAE
VREAVDFCRYYADLARKQFGAPTRLPGPTGESNELSLHGRGTFVCISPWNFPLAIFTGQV
AAALAAGNAVAAKPAEQTTLVGARAVRLFHTAGVPGDILHLLPGDGETVGAALVADARIG
GVAFTGSTETARLINRALAARDGAIVPLIAETGGQNAMIVDSTALLEQVVDDCITSAFQS
AGQRCSAMRVLFVQDDVADQMAHLLKGAMQLITLGDPLDLATDVGPIIDEDARKILVAHG
ERMDREAKLVHACPTGADLPNGTFFGPRLYEIDSLKRLPREVFGPILHLVRWKADSLDQV
LADIDATGYGLTLGVHSRLEGRAQEIFKRLNCGNTYINRNMVGAVVGVQPFGGHGLSGTG
PKAGGPHYLLRFATEKTLTVNITAFGGNADLLGLGG
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggcgaccgccccgtccagctctccctccccggccacgcccgaccttgacggt
ccccgcgcggccctgcgccgggccaaacatctgaatgaggagacggcggtgcgcgccctg
ctggcggcgcacggcctgacggcggaggaacgccgggcgattgacgcccaggcggtggac
gtggtcaacgccgcccgcgcccgccggtcggaactggggcccctggacgctttcatgcag
gagttcggcctgtccaaccaggagggcatcgccctcatgtgcatcgccgaatgcctgctg
cgcatcgccgatccggccacggccgaccggctgatcgccgagaagatcatgaaggggcag
tgggaccagcatctgggccagtcggacagcgccttcgtcaatgccgccgcctggggcctg
atgctgaccggccgggtggtggaggtcgacaccaagaagcagggtgacgcgcccggcctg
ctgcgccgcctggttcagcgctcgggcgagcccgtcatccgcgccgccatgatgaaggcc
atgcgggtcatgggcgaacacttcgtcatgggccgcactattgccgaggcggtggcggaa
gcgaagaaggcgaagccggaaggcaccgtccattcctatgacatgctgggcgagggggcg
cgcacctgggaacaggcggaccgctaccaggcctcctacctcaacgccatcgacacggtg
ggcaaggcggcggcgggccgtggcccttacgccgcccccggcgtctccatcaagctgtcg
gccctgcatccgcgctatgtcttcgccaagcgcgccgacgtcatggcccagctgctgccg
cgcgtgaaggatctgtgcctggccgccaagcgctgggacatcaacctgaccatcgatgcg
gaagaggcggaccgcctggacatctcgctggacctgctggaggccctggcgcgcgatggc
gacctcgccggctggaatggcctgggcctggccatccaggcctatcagaagcgcaccgcc
catctggtggactggctggcggcgctggcccgttccgccgggcgccggctgatggtgcgc
ctggtgaagggcgcctattgggacacggagatcaagttctcccagacccagggccacgcc
gactatcccgtctacaccaagaaggcggcgacggacctcagctacctggtgtgcgcgcgg
cggatgctggcggccaaggacgcgatctacccgcagttcgccacccacaacgcctacacc
atcgccgccatcctgcacctggcgggcgacaaccgcgacctggagttccagcgcctgcac
ggcatgggcgacctgctgtacgccgccgcccgcgaccgtctgaaggacgtgccgcgcgtg
cgcatttacgcacccgtcggcacgcatgaggacctgctgccctatctcgtccgccgtctc
ctggagaacggcgccaacagcaacttcgtcaacgcctacatggacccggccattccggtg
agccaggtggttgccgacccgatcgcccttttggaggctttgcccgtgctgcgccatgcc
ggtatcccgacccccgacaagctctatggtgacgaccgcgccaactcccgcggtgtcgac
ctgacggacgaggccacggtgcgcagcttgcgcgccggcatcgacgccgccctggcccag
gcctggacggccggccccatcgtcggcggccaggatctggccggccagaaggcccgcccg
gtgctggacccgtccgaccacacccgcaccgtgggcaccaccgccgacgccacggccgag
catatcgaccgcgccctggcgctggccgcccaggcccagccgggctgggacgcgctgggc
ggcgaggggcgcgcccgcatcctggacgccatgggcgacgcgctggaggccgacacgccg
gccctgctgggcatcctgatccgcgaggcgggcaagacctggggcgacgccgtggccgag
gtgcgcgaggcggtggatttctgccgctactacgccgatctcgcccgcaagcagttcggc
gcgcccacccgcctgccgggtccgacgggcgaaagcaacgagctgtcgctgcatggccgc
ggcaccttcgtctgcatcagcccgtggaacttcccgctggccatcttcaccggtcaggtg
gcggccgccctggccgccggcaacgccgtggcggccaagccggcggagcagaccaccctg
gtgggcgcccgcgccgtgcgcctgttccacacggccggcgtgccgggtgacatcctgcac
ctgctgccgggcgatggcgagacggtgggtgcggccctggtggccgacgcccgcatcggc
ggcgtggccttcaccgggtccaccgaaaccgcgcgcctgatcaaccgggccttggccgcc
cgggacggcgccatcgtccccctgatcgccgagaccggcggccagaacgccatgatcgtc
gacagcaccgccctgctggagcaggtggtggacgactgcatcacctcggccttccaatcg
gcgggccagcgctgctccgccatgcgcgtcctgttcgtgcaggacgacgtggccgaccag
atggcgcacctgctgaagggcgccatgcagttgatcaccctgggcgacccgctggatctc
gccaccgacgtcggccccatcatcgatgaggacgcccgcaagattctggtggcccatggc
gagcgcatggaccgcgaggccaagctggtccacgcctgccccacgggcgcggacctcccc
aacggcaccttctttgggccgcgcctctatgagatcgacagcctgaagcggctgccgcgc
gaggtgttcggccccatcctgcacctggtgcggtggaaggccgacagcctggaccaggtg
ctggccgacatcgatgccaccggctacggcctgaccctgggcgtgcacagccgcctggaa
ggccgggcgcaggagatcttcaagcgcctgaactgcggcaacacctacatcaaccgcaac
atggtgggcgccgtcgtcggcgtgcagcccttcggcggccacggcctgtccggcacgggt
cccaaggccggcggcccgcactatctgctgcgcttcgccaccgagaagacgctgaccgtg
aacatcaccgccttcggtggcaacgccgacctgctgggcctgggcggctga

DBGET integrated database retrieval system