KEGG   Nitrospirillum amazonense: Y958_09605Help
Entry
Y958_09605        CDS       T04935                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00010  Glycolysis / Gluconeogenesis
nao00071  Fatty acid degradation
nao00350  Tyrosine metabolism
nao00625  Chloroalkane and chloroalkene degradation
nao00626  Naphthalene degradation
nao01100  Metabolic pathways
nao01110  Biosynthesis of secondary metabolites
nao01120  Microbial metabolism in diverse environments
nao01130  Biosynthesis of antibiotics
nao01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y958_09605
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Y958_09605
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Y958_09605
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Y958_09605
   00626 Naphthalene degradation
    Y958_09605
Enzymes [BR:nao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Y958_09605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DUF1967
Motif
Other DBs
NCBI-ProteinID: ASG21051
UniProt: A0A248JRD5
Position
1:complement(2090463..2091488)
Genome map
AA seq 341 aa AA seqDB search
MTDMSAKTYRAIQVSRPGHLEMVDLPLVPPGPGQVRIRVEACGICHTDAMTVEGGVTDIV
YPRVPGHEVVGCIDALGEGVTGWALGRRVGVGFLAGNCGSCAECRRGHFTACRDQRWTGV
HHDGGYAEMMLAQANALVSIPDALAAVEAAPLLCAGITVFKALKKSGARPGDIVAIHGVG
GLGHLAVQFARKMGFRTVAIARGREKEGPAKALGAHHYINSAGEDAAAALLVLGGARVIV
STVTAPKAISPLVAGLAPHGRLMVVGVGAEPVEISPFALVQNDVSVSGSLTGTTIESEDS
LAFSVLQDIRALVETVPLAEARQAYDRMMRNQAQFRIVLTM
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatgagtgccaagacttacagggctatccaggtgtcccggcccgggcacctg
gaaatggtcgatctgccgctggtcccgcctggaccaggacaggtccgcatccgggtggaa
gcgtgcgggatttgccacaccgacgccatgaccgtggagggtggcgtgaccgacatcgtt
tatccccgggtgccgggtcacgaggtggtgggctgcatcgacgcgttgggcgagggggtg
accggctgggccctcggccggcgggtcggggttggattcctggcgggaaattgcggcagc
tgcgctgaatgccggcgaggtcatttcaccgcctgccgcgaccagcgctggacgggggtc
catcatgatggcggctatgccgagatgatgttggcgcaggcgaacgccctggtctccatt
cccgacgcgctggccgcagtcgaggcggcacccctgttgtgtgcgggcattaccgtcttc
aaggcgctgaagaagtccggcgcccggccgggcgacatcgtcgccatccatggggtcggc
gggttgggccacctggcggtgcagttcgcccgcaagatgggcttccgcacggtggccatc
gcccggggtagggagaaggaagggccggccaaggcgttgggcgcccaccattacatcaac
agtgccggcgaggacgccgccgccgcgctgctcgttctgggcggggcccgggtcatcgtc
tcgacggttacggcgcccaaagccatttcacccctcgtggctggcttggcgccgcatggg
cggctgatggtggtgggggtgggggcggaacccgtcgagatatcgccctttgcgctggtg
cagaacgatgtctccgtcagcggctccttgaccggtacgaccatcgaaagtgaggattcg
ctggcgtttagcgtgctccaggatatccgcgccttggtcgagaccgtgccccttgcggag
gcccgccaagcctatgaccgcatgatgcgcaaccaggcgcaattccgcatcgtcttgacg
atgtga

DBGET integrated database retrieval system