KEGG   Nitrospirillum amazonense: Y958_09845Help
Entry
Y958_09845        CDS       T04935                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00130  Ubiquinone and other terpenoid-quinone biosynthesis
nao00627  Aminobenzoate degradation
nao01100  Metabolic pathways
nao01110  Biosynthesis of secondary metabolites
nao01120  Microbial metabolism in diverse environments
nao01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Y958_09845
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Y958_09845
Enzymes [BR:nao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Y958_09845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ASG21928
UniProt: A0A248JUY2
Position
1:complement(2139595..2140191)
Genome map
AA seq 198 aa AA seqDB search
MTNAPSRLIVGISGASGVRYGVRLLETLRPLPIETHLVMSRSAEMTLAHETDMKPADVRA
LADVNHAVADVGAAISSGSFRTLGMVIAPCSIRTMSEIATGVTSSLLTRAADVVLKERRR
LVLMVRETPLHLGHLRTLTALAEMGAIIAPPVPAMYIRPASVDELVDHTVGRILDLFDID
GGRLRRWGEAPPEDTEIG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgccccctcccgcctcatcgtcggcatcagcggcgcctccggcgtgcgatac
ggcgtgcgcctgctggaaacgctgcgccccctgcccatcgagacccacctggtgatgagc
cggtcggcggagatgacgctggcgcatgagacggatatgaagcccgcagacgtgcgggcc
ctggcggacgtcaaccacgccgttgccgacgtgggcgccgccatctccagtggcagcttc
cgcaccctgggcatggtcatcgcgccctgttccatccgcaccatgagcgagatcgccacc
ggcgtgacctccagcctgctgacgcgggcggcggacgtggtgctgaaggaacggcggcgc
ctggtgctgatggtgcgcgagacgcccctgcacctgggccatctgcgcaccctgacggcc
ctggccgagatgggggccatcatcgccccgccggtgccggccatgtacatccggccggcc
agcgtggacgagctggtggaccataccgtcggccgcatcctggacctgttcgacatcgac
ggcggccgcctgcgccgctggggcgaagcgccgcccgaggataccgagatcgggtga

DBGET integrated database retrieval system