KEGG   Nitrospirillum amazonense: Y958_12700Help
Entry
Y958_12700        CDS       T04935                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
nao  Nitrospirillum amazonense
Brite
KEGG Orthology (KO) [BR:nao00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Y958_12700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: ASG21571
UniProt: A0A248JSW0
Position
1:2754091..2754483
Genome map
AA seq 130 aa AA seqDB search
MYSETTHAIRVSVRPEFLEDQSSPGEGHYVWAYTVRIENTGGETVQLRSRHWHITDARGR
VQEVRGAGVVGEQPVLSPGQSFEYTSGTPLSTPSGIMVGSYQMERTDGSRFDVRIPAFSL
DSPHERGALN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtgaaaccacccatgccatccgggtcagcgtgcgccccgaattcctggaggac
caatcgtccccgggggaaggtcactacgtctgggcctacaccgtgcgaatcgagaacacc
ggcggcgagacggtgcaactgcgcagccgccactggcacattaccgatgcccgcggccgg
gtgcaggaagtgcggggcgccggcgtggtgggcgagcagccggtgctgagccccgggcaa
tcctttgaatacaccagcggcacgccgctgagcacgccgtcgggcatcatggtcggcagc
tatcagatggaacgtacggacggcagccggtttgacgtgcgcatcccggccttctcgctg
gatagcccccatgaacgcggggcgctgaactga

DBGET integrated database retrieval system