KEGG   Nitrospirillum amazonense: Y958_13940Help
Entry
Y958_13940        CDS       T04935                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00630  Glyoxylate and dicarboxylate metabolism
nao01100  Metabolic pathways
nao01110  Biosynthesis of secondary metabolites
nao01120  Microbial metabolism in diverse environments
nao01130  Biosynthesis of antibiotics
nao01200  Carbon metabolism
Module
nao_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nao_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Y958_13940
Enzymes [BR:nao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Y958_13940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ASG22082
UniProt: A0A248JTM3
Position
2:complement(97052..97471)
Genome map
AA seq 139 aa AA seqDB search
MRLTQGTFSFLPDLTDEQITAQVQYCIDQGWAVNIEFTDDPHPRNTYWDMWGLPMFDIRD
AAGVMGELASCRKVYGDRYIRISGFDASHGWESVRLSFIVNRPANEPGFALERQESDGRR
VRYTTRSYATQLPEGERYS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcacccaaggaaccttctccttcctgcccgacctgacggacgagcagatcacg
gcccaggtgcagtactgcatcgaccagggctgggcggtgaatatcgagttcaccgacgac
ccgcacccccgcaacacctattgggacatgtggggcctgcccatgttcgacatccgcgac
gccgccggcgtcatgggcgagctggcgtcctgccgcaaggtctacggcgaccgctacatc
cgcatctccggcttcgacgccagccacgggtgggagagcgtgcgcctgtccttcatcgtc
aaccggcccgccaacgagcccggcttcgccctggaacgccaggaaagcgacggccggcgc
gtccgctacaccactcggtcctacgccacccagctgccggaaggggagcggtattcgtga

DBGET integrated database retrieval system