KEGG   Nitrospirillum amazonense: Y958_14600Help
Entry
Y958_14600        CDS       T04935                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00071  Fatty acid degradation
nao00072  Synthesis and degradation of ketone bodies
nao00280  Valine, leucine and isoleucine degradation
nao00310  Lysine degradation
nao00362  Benzoate degradation
nao00380  Tryptophan metabolism
nao00620  Pyruvate metabolism
nao00630  Glyoxylate and dicarboxylate metabolism
nao00640  Propanoate metabolism
nao00650  Butanoate metabolism
nao00900  Terpenoid backbone biosynthesis
nao01100  Metabolic pathways
nao01110  Biosynthesis of secondary metabolites
nao01120  Microbial metabolism in diverse environments
nao01130  Biosynthesis of antibiotics
nao01200  Carbon metabolism
nao01212  Fatty acid metabolism
nao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y958_14600
   00630 Glyoxylate and dicarboxylate metabolism
    Y958_14600
   00640 Propanoate metabolism
    Y958_14600
   00650 Butanoate metabolism
    Y958_14600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Y958_14600
   00072 Synthesis and degradation of ketone bodies
    Y958_14600
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Y958_14600
   00310 Lysine degradation
    Y958_14600
   00380 Tryptophan metabolism
    Y958_14600
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Y958_14600
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Y958_14600
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Y958_14600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nao04147]
    Y958_14600
Enzymes [BR:nao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Y958_14600
Exosome [BR:nao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Y958_14600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASG22193
UniProt: A0A248JTZ1
Position
2:complement(248327..249517)
Genome map
AA seq 396 aa AA seqDB search
MVTGNDVVIVGAVRTAVGGFLGSLKDITPADLGALVIGEALRRAGTAPEGVGHVVMGQVI
PSHPHDAYLARVAALRAGIPAAAPAMTLNRLCGSGLQAIISAAQAIRLGECDVAVAGGAE
SMSNAPHVLTSSRGGTKMGDAALTDALLTVLTDPFGHGHMGVTAENVAKRCGITREQQDT
FAAESHQRAARAIAEGRFKSQIVPVEIKSRKGTTLFDTDEHVRPDVSPAQLATLRPAFQR
DGTVTAGNASGINDGAAAVVLMSAAEAKRRNLPILSRLISWGHAGVAPEVMGLGPVGAVE
IALRRADLTVGDMDVIESNEAFAAQACAVSQHLGLPPEKTNPNGGAIALGHPLGATGAII
TVKALYELERIGGRYGLATMCIGGGQGIAMVLERRA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggttacaggcaatgacgtcgttatcgtcggggcggtgcgaaccgccgtgggcgggttc
ctcggctcgctgaaggacatcacgccggccgacctcggcgccctcgtcatcggcgaggct
ctgcgccgggccggcaccgccccggagggggtgggccacgtcgtcatggggcaggtcatc
cccagccacccccatgacgcctatctggcccgggtggccgcactgcgcgccggcatcccg
gcggcggcccccgccatgaccctgaaccggctctgcggttccggcttgcaggccatcatt
tcggcggcacaggctatccggctgggggaatgcgatgtcgcggtcgccggcggggcggaa
agcatgagcaacgccccccacgtgctgacctcctcgcgcggcggcaccaagatgggcgac
gccgctttgacggacgccctgctgaccgtcctgacggatcccttcggccacggccacatg
ggggtcacggccgagaacgtggcaaagcggtgcggcattacacgggaacagcaggacacc
ttcgccgccgagagccaccagcgggcggcgcgagccatcgccgagggccgcttcaagtcc
cagatcgtcccggtcgagatcaagagccgcaagggcaccaccctgttcgacaccgatgag
catgtgcggcccgacgtgtcgccggcgcagctcgcgaccctgcgccccgccttccagcgc
gacggcaccgtcacggccggcaacgcctccggcatcaatgacggggcggccgccgtggtg
ctcatgtccgccgcggaggccaagcggcggaacctgccgatcctgtcccgcctcatatcc
tggggtcacgccggtgttgccccggaggtgatgggcctgggtccggtaggcgccgtggaa
atcgccttgagacgagccgacctgacggtcggggacatggacgtcatcgagagcaacgag
gccttcgccgcccaggcctgtgccgtctctcagcacctgggtctgccgcccgaaaaaacc
aatccgaacggcggcgccatcgcattgggccaccctctgggcgccaccggcgccatcatc
accgtcaaggcactgtatgagctggagcgtatcggtggccgctatggcctggccaccatg
tgcatcggcggaggacagggtatcgcgatggtgctggagcgccgggcatag

DBGET integrated database retrieval system