KEGG   Nitrospirillum amazonense: Y958_19945Help
Entry
Y958_19945        CDS       T04935                                 

Gene name
cobA
Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00860  Porphyrin and chlorophyll metabolism
nao01100  Metabolic pathways
nao01110  Biosynthesis of secondary metabolites
nao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Y958_19945 (cobA)
Enzymes [BR:nao01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Y958_19945 (cobA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Y958_19945 (cobA)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Y958_19945 (cobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: ASG23124
UniProt: A0A248JY49
Position
2:1523606..1525084
Genome map
AA seq 492 aa AA seqDB search
MSAAFPLFLTLTGQTVLIVGGGELALRKARLVAGAGGDGRGARLVVVAPEVHPDLAALAA
EVRRRPFAASDLDGVTLVFAAGEDEDEAARVADLARARGLLVNVPDRPALSTFIMPAIVD
RGPITVAISTGGTSPVLARRLRARIEAALEPGLGRLATFLDGFRTAVRAVKSDETARRRF
WERVIDGPVAQRFLAGDEAGAHEQLVKALNAGDAGDAIEGGSVALVGAGPGDPDLLTLRA
LRVLQNADVVVHDKLVDDRILDYVRRDARRVYVGKSKSCHTVSQDEINALLVREAQAGHR
VVRLKGGDPFIFGRGGEEMAVLRAAGVAVELVPGITAAVGCAAATGIPLTHRGLAQGITL
VTAHGAAAEGGSAEPAIDWTALARLDHTLAVYMGLSKAGLVAERLIAAGKAPGTPVAVVQ
NGTRPDQTLAVGRLADLGALAAGLAGPALILVGEVVTLADPSKIAADIFTTVSSAPGRLG
DTTPERGLKAAV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccttccccctgttcctgacactgaccggccagacggtgctgatcgtcggt
gggggggaattggccctgcgcaaggcgcgcctggtggcgggcgccggcggcgacggccgc
ggcgcacgcttggtggtggtggcgcccgaagtgcacccggacctggccgcgctggccgcc
gaggtgcgccgccgccccttcgccgcctctgatttggatggcgtcaccttggtgttcgcc
gccggcgaggatgaggatgaggcggcccgggtggccgacctcgcccgcgcccggggcctg
ctggtcaacgtgccggatcgccccgccctgtccaccttcatcatgccggccatcgtcgac
cgggggcccatcacggtggccatttccaccggcggcacctcacccgtcctggcccgccgc
ctgcgcgcccgcatcgaggcggcgctggaaccgggcctggggcggctggccaccttcctc
gacggcttccgcaccgccgtccgcgctgtgaaatccgacgagaccgcgcgccgccgcttc
tgggagcgggtgatcgacggccccgtcgcccagcgcttcctggccggtgacgaggctggc
gcgcatgagcagctggtgaaggccctgaacgccggtgatgccggtgacgccatcgaaggc
ggctccgtcgccttggtgggtgccggccccggcgacccggatctgctgaccctgcgcgcc
ctgcgcgtgctgcagaacgccgacgtggtggtgcatgacaaactggtggacgaccgcatc
ctggattacgtccgccgcgacgcccgccgcgtctatgtcggcaagtccaagtcctgccac
accgtcagccaggatgagatcaacgccctgctggtgcgcgaggcccaggccggccaccgt
gttgtccggctgaagggcggcgaccccttcatcttcggccgggggggcgaggagatggcc
gtgctgcgcgccgccggcgtggcggtggaactggtgcccggcatcactgccgccgtgggc
tgcgccgccgccaccggcattcccctgacccatcgcggcctggcccagggcatcaccctg
gtgaccgcgcatggcgccgccgccgagggcggttcggccgagcccgccatcgactggacg
gccctggcccgcctggaccacacgctggccgtctacatgggcctgagcaaggccggcctg
gtggccgagcgcctgatcgccgccggcaaggcgcccggcaccccggtcgccgtggtgcag
aatggcacgcgcccggaccagaccctggccgtgggccgactggccgacctgggcgcgctg
gccgccggcctggccggtcccgccctgatcctggtgggggaggtcgtgaccctggccgac
ccctcaaaaatcgccgccgatattttcaccaccgttagctccgccccgggccgcctcggc
gacacgaccccggaacgcgggctgaaagccgccgtctga

DBGET integrated database retrieval system