KEGG   Nitrospirillum amazonense: Y958_25595Help
Entry
Y958_25595        CDS       T04935                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00260  Glycine, serine and threonine metabolism
nao01100  Metabolic pathways
nao01110  Biosynthesis of secondary metabolites
nao01120  Microbial metabolism in diverse environments
nao01130  Biosynthesis of antibiotics
nao01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Y958_25595
Enzymes [BR:nao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Y958_25595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ASG24282
UniProt: A0A248K008
Position
3:857434..858465
Genome map
AA seq 343 aa AA seqDB search
MNFMSDNVVGAAPEILAALAAANEGAQPSYGGDPLTARVTRDLAELFECDVTVFPVATGT
AANALALSVLTPPYGAVYCHDEAHVEVDECGAPELMSGGAKLVPLAGPHGKLDAMALKAA
LDKGGAGVVHHVQPAALTLTQATESGTVYTPDEVMALTEVARAHKLRVHMDGARFANAVA
SLACAPADITWRAGVDVLSFGATKNGALAAEAVIFFDKALADNFAYRRKRAGHLFSKMRF
LSAQLDAYLTDGLWLRLATHANAMATRLAQGLDALPGVGLRSPVQANEVFAVMPEPMIAG
LEAAGFHFYRWDGACIRLVTAWNTDPAHVDAFAAAARGLAGIA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcatgagcgacaatgtggtgggcgcggccccggagatcctggcggccctggcc
gcggccaatgagggcgcgcagccctcttacggcggcgacccgctgacggcgcgggtgacc
cgggacctggccgaattgttcgagtgcgacgtcaccgttttccccgtcgccaccggcacc
gccgccaacgcgctggccctgtcggtgctgaccccgccttacggcgccgtctattgccat
gacgaggcccatgtggaggtggatgagtgcggcgcgccggagctgatgtccggcggcgcc
aagctggtcccactggcgggcccccatggcaagctggacgcgatggcgctgaaggccgcc
ttggacaagggcggcgccggcgtcgtccaccatgtgcagccggctgcgctgaccctgact
caggcgacggagtccggcacggtctacacccccgacgaggtcatggccctgacggaggtg
gcgcgggcgcacaagctgcgcgtccacatggacggggcccgcttcgccaacgccgtggcc
agcctggcctgcgccccggccgacatcacctggcgcgccggcgtggacgtgctgtccttc
ggtgccaccaagaacggcgccctggcggcggaggcggtgatcttcttcgacaaggccctg
gccgacaacttcgcctatcgccgcaagcgggccggccatttgttctccaagatgcgcttc
ctgtcggcacagttggacgcctacctgacggacggcctgtggctgcgcctggccacccac
gccaatgcgatggcgacgcgcctggcccagggcctggacgccctgcccggcgtcggcctg
cgcagcccggtacaggccaacgaggtcttcgccgtgatgccggagccgatgatcgctggc
ctggaggccgccggcttccacttctaccgctgggatggcgcctgcatccgcctggtgacc
gcctggaacaccgacccggcgcatgtggatgccttcgccgccgccgcgcgggggctggcg
ggaatcgcgtga

DBGET integrated database retrieval system