KEGG   Nitrospirillum amazonense: Y958_27190Help
Entry
Y958_27190        CDS       T04935                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nao  Nitrospirillum amazonense
Pathway
nao00010  Glycolysis / Gluconeogenesis
nao00053  Ascorbate and aldarate metabolism
nao00071  Fatty acid degradation
nao00280  Valine, leucine and isoleucine degradation
nao00310  Lysine degradation
nao00330  Arginine and proline metabolism
nao00340  Histidine metabolism
nao00380  Tryptophan metabolism
nao00410  beta-Alanine metabolism
nao00561  Glycerolipid metabolism
nao00620  Pyruvate metabolism
nao00625  Chloroalkane and chloroalkene degradation
nao00903  Limonene and pinene degradation
nao01100  Metabolic pathways
nao01110  Biosynthesis of secondary metabolites
nao01120  Microbial metabolism in diverse environments
nao01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y958_27190
   00053 Ascorbate and aldarate metabolism
    Y958_27190
   00620 Pyruvate metabolism
    Y958_27190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Y958_27190
   00561 Glycerolipid metabolism
    Y958_27190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Y958_27190
   00310 Lysine degradation
    Y958_27190
   00330 Arginine and proline metabolism
    Y958_27190
   00340 Histidine metabolism
    Y958_27190
   00380 Tryptophan metabolism
    Y958_27190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Y958_27190
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Y958_27190
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Y958_27190
Enzymes [BR:nao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Y958_27190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASG24551
UniProt: A0A248K1E7
Position
3:complement(1308503..1309930)
Genome map
AA seq 475 aa AA seqDB search
MYRIDTVYIGGTFQPAHGREELLLLNPTTEAPMGVLVLADEEDARRAVASAVGAFPTWSR
SGRQERMDLLNALAEAVRRRADDLTEATILEYGGPIEQARWRAGLAANNFLAAATLLEDY
AFTRRINEVEVVAQAVGVATHIVPWNSVYNAISVKMAGALAAGCPVVVKPSEYSAWQVQL
FTECLHAAGAPAGVVNVVNGRGVVAGQALAAHPDVCKISFTGSTPVGKSILRTAAERMAR
VTLELGGKSPTIVMDDADLAKAAALALSIGYANNGQACIAGTRILVPRARVDAFCEALRV
AMRDVVPGDPRIARTTLGPLVNHRQYDRVQAYIRKGLEEGARLVTGGPGRPEGITRGYFV
QPTIFADVTNDMTIAREEIFGPVLCVIAYDDDDHAVAIANDTPYGLHAYIIGQDMGRARA
IADRVDAGRVAINALTHEPLAPFGGFKQSGVGREYGAFGIEAHLELKAVIGAARS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcatcgacacagtctatatcggcggcacgttccagccggcccatggccgcgag
gaactgctgttgctcaaccccacgaccgaagcgcccatgggcgttctggtcctggcggat
gaggaggatgcccggcgggcggtggccagcgccgtcggggccttccccacctggtcgcgc
agcggccggcaggaacgtatggacctgctgaacgccctggcggaggcggtgcgccgccgc
gccgacgacctgaccgaagccaccatcctggaatatggcggtcccatcgagcaggcgcgc
tggcgcgccggcctggcggcgaacaattttctggccgccgccacgctgctggaggactac
gccttcacccgccgcatcaatgaggtggaggtggtggcccaggctgtgggcgtcgctacg
cacatcgtgccctggaacagcgtctacaacgccatcagcgtgaaaatggcgggggcgctg
gcggccggctgcccggtggtggtcaagcccagtgaatacagcgcctggcaggtgcaactg
ttcaccgaatgcctgcacgcggcgggtgccccggccggtgtcgtcaatgtcgtcaacggt
cgtggcgtcgtggcgggccaggccctggccgcccatcctgatgtctgcaaaatctccttc
accgggtccacgcccgtgggcaaatccatcctgcgcacggcggcggagcgcatggcccgt
gtgaccctcgaactgggcggcaagtcgccgaccatcgtcatggacgacgccgacctggcc
aaggcggcggcgctggccctgtccatcggctatgccaacaacggccaggcctgcatcgcc
ggcacccgcatcctggtgccccgcgcccgtgtggacgctttttgcgaggcactccgggtc
gcgatgcgggacgtggtgcccggcgacccccggatcgcgcgcaccaccctggggcccctg
gtgaaccaccgccagtacgatcgcgtccaggcctatatccgcaagggcctggaggagggc
gcgcggctggttaccggcggtcccggccggccggaaggcatcacgcgtggctatttcgtc
cagcccaccatcttcgcggacgtgaccaacgacatgaccatcgctcgggaggaaatcttc
ggccccgtgctgtgcgtcatcgcctatgacgatgacgaccacgccgtggccatcgccaac
gacacgccctacggactgcacgcctacatcatcggccaggacatgggtcgggcgcgggcc
atcgccgaccgcgtcgatgccggccgggtggcgatcaacgccctgacgcacgagcccctg
gcccccttcggcggtttcaagcaatccggcgtggggcgggaatatggcgccttcggcatc
gaggcgcatctggagctgaaagccgtcatcggggcggcccgctcataa

DBGET integrated database retrieval system