KEGG   Nitrospirillum amazonense: Y958_27505Help
Entry
Y958_27505        CDS       T04935                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
nao  Nitrospirillum amazonense
Pathway
nao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nao00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Y958_27505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:nao02022]
    Y958_27505
Two-component system [BR:nao02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Y958_27505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: ASG24605
UniProt: A0A248K0V0
Position
3:complement(1388224..1389078)
Genome map
AA seq 284 aa AA seqDB search
MIGEKARPDQQAGCLGRKIATMSRGRRFTLSSGVHTSLSKAASMIPPPPDDGLKRQGRIL
LVEDDDRLAPLVVRHLADSGFQIDWAADAAAADAHLRAHPVDLAVLDIMLPGEDGLSLCR
RIRRDHDIGIIMVTARGQEADRIRGLDLGADDYLPKPYSLWELEARAKAVLRRCVRAGPM
AAPPAIHHAGPFRIDAGSRAASLHGQALDLTRTEFDLLARLAGEPGRVFSRDMLLECVRG
GETDAFDRAVDTHISNLRRKIGDDPKAPTFIRTVWGVGYRFHLL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgataggggagaaggcgaggcccgaccagcaggcaggctgcttaggccgtaagattgcg
actatgtcgcggggccggcgtttcacgctatcgtcgggcgtgcatacatcgctgtcaaag
gccgcctccatgatcccacccccgcccgacgatggtctgaaacgccagggccgcatcctg
ctggtggaagatgatgaccggctcgcgcccctggtggtgcgccatttggccgacagcggt
ttccagatcgactgggcggcggacgcggcggcggcggacgcgcatctgcgggcgcatcct
gtcgatctggcggtgctggacatcatgctgccgggggaggatggcctgtccctctgccgc
cgtatccgccgcgaccacgacattggcatcatcatggtcaccgcccgggggcaagaggcc
gaccgcatccgcggcctggacctgggcgccgacgactacctgcccaagccctacagcctg
tgggagctggaggcgcgggccaaggcggtgctgcgccgctgcgtccgggcgggcccgatg
gcggccccgccggccatccaccatgccggtcccttccgcatcgacgccggcagccgcgcc
gccagcctgcatggccaggccctggatttgacgcgcaccgaattcgacctgctggcccgc
ctggcgggggagcccgggcgggtgttcagccgcgacatgttgctggaatgcgtgcggggc
ggggagacggacgccttcgaccgcgccgtcgacacccatatcagcaacctgcgccgcaag
attggcgacgaccccaaggcccccaccttcatccgcacggtgtggggcgtgggctaccgg
ttccacctgttatga

DBGET integrated database retrieval system