KEGG   Nautilia sp. PV-1: C3L23_08435Help
Entry
C3L23_08435       CDS       T05986                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nap  Nautilia sp. PV-1
Pathway
nap03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nap00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C3L23_08435 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nap03011]
    C3L23_08435 (rplV)
Ribosome [BR:nap03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C3L23_08435 (rplV)
  Bacteria
    C3L23_08435 (rplV)
  Archaea
    C3L23_08435 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 ptaRNA1_toxin
Motif
Other DBs
NCBI-ProteinID: AZV47297
UniProt: A0A3T0L3Z6
Position
complement(1606323..1606643)
Genome map
AA seq 106 aa AA seqDB search
MSKAVLKFIRLSPTKARLIAKEIQGMNAEEALAKLEFMPNKAARVIAKVVASAVANGGYD
ANEVVITSCRIDRGPYLKRFRPRARGMASRIQKPTAHIFVEVEKES
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcagtattaaaatttataagactatccccaactaaagcaagattgattgct
aaagaaattcaaggtatgaatgctgaagaagcacttgctaaattagaatttatgcctaat
aaagcggcaagagttatcgctaaagttgttgcaagtgcggttgcaaacggcggatatgat
gcaaatgaagtagttattacttcatgcagaatcgacagaggtccgtatctaaaaagattc
agaccaagagctagaggtatggcgagcagaatccaaaaacctacagcacacatttttgta
gaagttgaaaaggaaagctaa

DBGET integrated database retrieval system