KEGG   Novosphingobium aromaticivorans: Saro_0323Help
Entry
Saro_0323         CDS       T00322                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00860  Porphyrin and chlorophyll metabolism
nar01100  Metabolic pathways
Module
nar_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Saro_0323
Enzymes [BR:nar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Saro_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ABD24771
UniProt: Q2GBK2
Position
complement(347644..349119)
Genome map
AA seq 491 aa AA seqDB search
MLQGTGSDVGKSVLVAGLCRALVQRGLRVLPFKPQNMSNNAAVTSDGGEIGRAQALQAIA
CKVEPHTDMNPVLLKPQADRTSQLIVHGRVRGTLGAGNFRQARGALLGEVLASYNRLRRA
CDIVVVEGAGSPAEINLRAGDIANMGFARAAGVPVVLVGDIDRGGVIAAIVGTRTIIDPA
DTAMIQGFIINKFRGDPALFADGYAQIESLSGWRGFGVVPWLSAAARLPSEDAVVLESGK
ARAESRKLIACPILPRISNFDDLDPLKLEHGVDLHMVPPGQPIPAEAALIILPGSKSTIA
DLAALRAEGWDIDIFAHHRRGGLILGLCGGYQMLGKSIADPDGFEGSASAASGLGLLDVE
TTLHAHKALRPVSGLAMGAPFQGYEMHMGQTNGPDTEQPFAVFADGRRDGAINAGGTVFG
SYVHGLLADAELRRALLSRMDVEAGGVDYGASVEAALDEIAAALEEHLDIDALVALAMAE
RPASVPAGDSA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagggcaccggctctgatgtgggcaaatccgtgctggtggcggggctgtgccgc
gccctggtgcagcggggtttgcgggtcttgccgttcaagccgcagaacatgtcgaacaat
gctgccgtcaccagcgatggcggcgagatcggccgggcgcaggccttgcaggcaatcgcc
tgcaaggtggagccgcataccgacatgaatccggtgctgctgaaaccgcaggccgaccgc
acatcgcaactgatcgtgcatggtcgggtgcgcggcacattgggcgcgggcaattttcgg
caggcacggggcgcgctgctcggcgaagttctggccagctataaccggctccgccgggcg
tgcgacatcgtcgttgtcgagggtgccggctctcctgcggaaatcaacctgcgcgctggc
gacatcgccaatatgggctttgcgcgagcggcaggcgtgcccgtcgtgctggtcggcgat
attgatcgcggcggagtcattgccgccatcgttggcacgagaacgatcatcgaccccgcc
gacacggcgatgatccagggtttcatcatcaacaagtttcggggggatcccgccctgttc
gccgatggctacgcccagatcgaaagcctctcaggctggcgcggcttcggcgttgtccca
tggttgagcgcggcggcgcggctccccagcgaggatgccgtggtgctggagagcggcaag
gcgcgggctgaaagccgcaagctgatcgcctgtccgatcctgccgcgcatatctaatttc
gatgacctcgatccgctgaagctcgaacatggtgtggacctgcacatggttccgcccggc
cagccgatcccggcagaggccgcactcatcatcctgcccgggtcaaagtcgacaatcgcc
gatctggccgctctgcgtgcagagggctgggacatcgatatttttgcgcatcaccggcgc
ggcgggctgatccttgggctttgcggtggttaccagatgctcggcaaaagcatcgccgat
cccgatgggtttgaaggttcggccagcgctgccagcggccttggcctgcttgatgttgaa
acgaccttgcacgcgcacaaggcgttgcgtccggtcagcgggctggcgatgggcgcgcca
ttccagggatatgaaatgcacatggggcaaaccaacgggccggatacggaacagcccttc
gccgttttcgccgatggccgccgcgatggcgcgataaatgcgggcggcacggtgtttggt
tcctatgtccacggcctgctggctgatgcggagctgcgccgggcgctgctgtcgcgcatg
gatgtagaagccgggggcgtggactatggcgcctctgtcgaggcggcgctggacgagatc
gcagccgcgcttgaggagcatctcgatattgacgcgctggtggcgctggccatggcggag
agacccgcttccgtcccggcgggagacagcgcatga

DBGET integrated database retrieval system