KEGG   Novosphingobium aromaticivorans: Saro_1131Help
Entry
Saro_1131         CDS       T00322                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00471  D-Glutamine and D-glutamate metabolism
nar00550  Peptidoglycan biosynthesis
nar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Saro_1131
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Saro_1131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nar01011]
    Saro_1131
Enzymes [BR:nar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Saro_1131
Peptidoglycan biosynthesis and degradation proteins [BR:nar01011]
 Precursor biosynthesis
  Amino acid ligase
   Saro_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABD25576
UniProt: Q2G997
Position
1176396..1177727
Genome map
AA seq 443 aa AA seqDB search
MIVSRAFAGKRYAVLGLARSGLASVESLLAGGADVTVWDNREEPRSAFEGSCTIADPLSI
DLTGFAGVVVSPGVPLNRHPIADHARAAGVPVIGDIELFAQARADLPPHRVVGITGTNGK
STTTMLVHHICAAAGLPARLGGNIGLPILGQEPLPEGGVYVLELSSYQIDLTQSLACDVA
ALINLSPDHLDRYDGFAGYAASKARLFAMQRADQHAVFGCGDEHTLEIAREASATHDTGF
VHVVQPSALHGQLEWPSLQGPHNLQNAAIAVEIARQLGIAEDIWRSALASFVGLPHRMER
VAEANGVLFVNDSKATNPASTAPALGAYPRIHWILGGLPKSDNLDECAPYFDHVVAAYTI
GEAGPRFAEILEPVMPVTRSEMLCDAVRQAMEAAQPGDVVMLSPACASFDQFRDFEARGD
SFRQIVEALIEDREAPCPDGTPT
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtctcgcgcgcctttgccggaaagcgttacgcggttctcggtctcgcgcgctcg
ggccttgccagcgtcgaaagcctgctggccggcggcgctgacgtcaccgtctgggacaac
cgcgaggaaccgcgcagcgcattcgaagggagctgcaccatcgccgacccgctgtccatc
gacctgacaggctttgcgggtgtcgtggtttccccgggcgtgccgctcaaccgccacccc
atcgccgaccatgcgcgcgccgctggcgttccggtgatcggtgacatcgagttgttcgcc
caggcgcgcgccgaccttccgccacatcgcgtggtcgggatcacgggcaccaacggcaag
tcgacgacaacgatgctggtccaccacatctgcgccgccgctggccttcccgcgcggctc
ggcggcaatatcggcctgccgatcctcgggcaggagcccttgcccgaaggcggggtctac
gtgctcgagctgtcgagctaccagatcgacctgacccagagcctggcctgcgacgtagcc
gcgctgatcaacctcagccccgatcaccttgaccgttatgacggctttgccggctatgcc
gcatcgaaggcgcgcctcttcgcgatgcagcgggccgaccagcacgcggtcttcggctgc
ggcgacgagcacaccctcgagatcgcgcgcgaggcgtcggcaacccacgacacgggcttt
gtccacgtcgttcagccgagtgcgcttcacggccagctcgaatggccttcgctgcaaggt
ccgcacaacctccagaacgccgccatcgcggtagagatcgcgcggcagcttggcattgcc
gaggatatctggcgttcagcgctggccagcttcgtcggcttgccgcaccgaatggagcgc
gtggccgaggccaacggcgttctcttcgtgaacgacagcaaggcgactaacccggcttcc
accgcccctgcgctcggcgcctatccgcgcatccactggatactcggcggtctgcccaag
agcgacaacctcgacgagtgcgcgccctatttcgatcacgtcgttgcggcctataccatc
ggcgaggccgggccgcgctttgccgagatcctcgaacccgtgatgcccgtcacccgcagc
gagatgctgtgcgatgcggtgcgccaggctatggaggccgcgcagccgggcgatgtcgtc
atgctgtcgcccgcctgcgccagcttcgaccagttccgcgatttcgaggcgcgtggcgat
tcctttcggcagatcgtcgaggcgctgatcgaggatcgggaagcgccctgtccggacgga
acgccgacgtga

DBGET integrated database retrieval system