KEGG   Novosphingobium aromaticivorans: Saro_1283Help
Entry
Saro_1283         CDS       T00322                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00281  Geraniol degradation
nar00310  Lysine degradation
nar00360  Phenylalanine metabolism
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00410  beta-Alanine metabolism
nar00627  Aminobenzoate degradation
nar00640  Propanoate metabolism
nar00650  Butanoate metabolism
nar00903  Limonene and pinene degradation
nar00930  Caprolactam degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Saro_1283
   00650 Butanoate metabolism
    Saro_1283
  Lipid metabolism
   00071 Fatty acid degradation
    Saro_1283
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_1283
   00310 Lysine degradation
    Saro_1283
   00360 Phenylalanine metabolism
    Saro_1283
   00380 Tryptophan metabolism
    Saro_1283
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Saro_1283
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Saro_1283
   00281 Geraniol degradation
    Saro_1283
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_1283
   00627 Aminobenzoate degradation
    Saro_1283
   00930 Caprolactam degradation
    Saro_1283
Enzymes [BR:nar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Saro_1283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 UPF0444 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABD25727
UniProt: Q2G8U6
Position
1325623..1326387
Genome map
AA seq 254 aa AA seqDB search
MSEAEVLTQVDGNVLVVTINRPDAKNAMNKAAAEGIAAAMDRLDAEADLRCAILTGAGGT
FCSGMDLKGFLRGESPSIPGRGFGGLSEWTPKKPIIAAVDGYALAGGMELALSCDLIVAS
ASSKFGIPEAKRGLAAAAGGLIKLPRQIPPRIAMELALTGDFITAQRAYELGFINQVVEG
PSLDAAKALAARVAENGPLALIASKGIIRDSHEWTEAEMWKKQQAYIAPVFSSSDAREGA
AAFAEKRKPNWQGK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcggaagtccttacccaagtcgatggcaacgtgctggtcgtcacgatcaac
cgtcccgatgcgaagaacgcgatgaacaaggccgcggccgagggcatcgcagcggcgatg
gaccggctcgatgccgaggcggacctgcgctgcgcgatcctgacgggggcgggcggaacg
ttctgttcgggcatggacctcaagggcttcctgcgtggcgaatcgccctcgatcccgggg
cgcgggttcggcgggctttccgaatggacgccaaagaagccgatcattgctgcggtcgat
ggctatgcgcttgcgggcggcatggaactcgcgctgtcgtgcgacctgatcgtggccagc
gcttcctcgaagttcggcattcccgaagccaagcgcggccttgccgccgccgccggcggg
ctgatcaagctgccgcgccagatcccgccgcgcattgcgatggaactggccctgaccggc
gacttcatcaccgcccagcgcgcctatgaactcggcttcatcaaccaggttgtcgaaggc
ccgtcgctcgacgccgccaaggctctcgccgcgcgcgtggccgagaacggtccgctggcc
ctgatcgcctcgaaggggatcatccgcgattcgcacgaatggaccgaggccgagatgtgg
aagaagcagcaggcttacatcgctcccgtattctcctccagcgacgcccgcgaaggcgcc
gccgctttcgccgagaagcgcaagcccaactggcagggcaagtaa

DBGET integrated database retrieval system