KEGG   Novosphingobium aromaticivorans: Saro_1552Help
Entry
Saro_1552         CDS       T00322                                 

Definition
(GenBank) Twin-arginine translocation pathway signal
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00562  Inositol phosphate metabolism
nar00564  Glycerophospholipid metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Saro_1552
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Saro_1552
   00565 Ether lipid metabolism
    Saro_1552
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Saro_1552
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:nar02042]
    Saro_1552
Enzymes [BR:nar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Saro_1552
Bacterial toxins [BR:nar02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Saro_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ABD25992
UniProt: Q2G831
Position
1607077..1609185
Genome map
AA seq 702 aa AA seqDB search
MSNTRRDFLKSAAIGGVAGTLPASIARALAVPARRTTGTIQDVRHVVILMQENRSFDHYF
GTLKGVRGFGDRHPVPMEGGRSVWWQHNGARHLPPFHLDTRTTNALKVPGTPHSFADAQA
AWNQGKFGLWPKFKTDYSMGYYRREDIPFQFALAEAFTICDAYHCSVTSGTDPNRIVFWS
GAGFDPELCAQGINSRADRSEPDNLRCWIKGALPEPGYTYASNALMWKTIPEVLEDAGVD
WRIYQDPNDNWTGAMHGGLAFEGFRKSRPGEPLYEKGMRHHSLEQLARDVQQGTLPAVSW
VLPPKPWSEHPSSSSPIEGAEFTARVLDALSANPEVWSGTVFFQTFDENDGLFDHLPPAA
PPSYNADGTLAGKATLRLDGHYFDDNEDRHTSRDDVISGHLRPFGLGPRVPMYVVSPWSK
GGWVNSEVFDHTSVGQFLEKRFGITVPAISPWHRAVCGDMTSCFDFSRDGDARFPELPDV
SNSVATISRHQQQARLLPPREPQGLFQEQGLRRSRALPYRLEVDASIEAGRVTLAFVNSG
SVGAVFHVYDRQHLDRIPRRYTVEAGKQLEDVWQFGGDAGFDLWVLGPNGFLRHFMKKAA
TAGEVPGVRIRTSARQARLDLAFSNPGGESVAVTLGDDAYGFAQTRQVVVPAGGTTRAVW
NAERSQDWYDFTITTAGVAIRAAGRIERGIDGVSDPLMATVA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacacaagacgcgatttcctgaaatccgccgcaatcggcggggttgcagggacc
cttccggccagcatcgcgcgggcgctcgccgtgcccgcgcgccggaccacaggtacgatc
caggacgtgcggcacgtcgtcatcctgatgcaggaaaatcgctcgttcgatcactacttc
ggaacgctgaaaggcgtgcgcggcttcggtgatcgccatccagtgcccatggaggggggg
cgatccgtctggtggcagcacaatggggcgcgtcacttgccgccattccacctcgatacc
aggaccaccaatgcgctgaaggtgccaggcaccccgcatagcttcgccgatgcgcaggct
gcttggaaccagggcaagttcggcctctggcccaaattcaagaccgactattcgatgggc
tactaccgccgggaggatattcccttccagttcgccttggccgaggctttcaccatctgc
gacgcctatcactgctcggtgaccagcggaacggacccgaaccgcattgtcttctggtcc
ggggcaggcttcgatcccgagctgtgcgcgcagggcatcaattcgcgtgccgaccgcagc
gagcccgacaatctgcgctgctggatcaagggtgccctgcccgagccgggctacacctac
gcctccaatgcgctgatgtggaaaaccattcccgaagtcctcgaagatgcaggcgtcgat
tggcggatctaccaggaccccaacgacaactggacaggcgcgatgcacggtggccttgcc
ttcgagggcttccgcaagtcccgcccgggcgaaccgctctatgaaaagggcatgcgccac
cattcgctcgagcagcttgcccgcgacgtgcagcagggcaccctgccggctgtctcgtgg
gtgctgccgcccaaaccctggtcggaacacccttcctcctcgtcgcctatcgagggagct
gagtttaccgcacgcgtcctcgatgcgctttctgccaaccccgaagtgtggagcgggacc
gtattcttccagaccttcgacgagaacgacggcctgtttgatcacctgccgcccgctgcg
ccgccgtcctacaacgccgatggtactctggcgggcaaggcgaccctcaggctcgatgga
cactacttcgatgacaacgaagaccgtcacacctctcgcgacgatgtgatttcaggccat
ctgcggccgttcggcctcggtccgcgcgtgccgatgtacgtggtttctccgtggagcaag
ggcggctgggtcaacagcgaggtgttcgatcatacctcggtcggccagttcctcgaaaag
cgcttcgggatcactgttcccgcgatcagcccatggcaccgcgcagtgtgcggcgacatg
acctcctgcttcgatttctcgagggacggagacgcccgctttcccgaactgccggacgtg
tcgaactccgtggcgacgatctcacgccaccagcagcaagcccgtctgctgccgccgcgt
gaaccgcagggccttttccaggagcagggtttgcgccgctcccgcgcgctgccctatcgt
ctcgaggtggatgccagcatcgaggcagggcgcgtcacgttggccttcgtcaacagcggc
agcgtaggcgcggtcttccatgtctatgaccgccagcatctcgaccgcatcccccggcgc
tacacggtcgaggcgggcaagcagctagaagacgtctggcagttcggcggtgacgccggt
ttcgacctgtgggtgcttggcccgaacggtttcctgcgccacttcatgaagaaggcggcg
acggcaggtgaagtgcccggcgtgcgcatccgcacatccgcccggcaggccaggcttgat
cttgcattctccaacccgggcggagaaagcgtcgcggtcacgctaggcgacgatgcctac
gggttcgctcaaacacgtcaggtcgtagtccccgccggcggaaccacgcgtgccgtctgg
aatgcggagcgaagccaggactggtacgatttcaccatcacgacggcaggagtcgccatt
cgtgcggccggacgcatcgagcgcggtatcgacggggttagcgacccgctcatggcgacg
gttgcctga

DBGET integrated database retrieval system