KEGG   Novosphingobium aromaticivorans: Saro_1695Help
Entry
Saro_1695         CDS       T00322                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nar00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Saro_1695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nar03400]
    Saro_1695
Enzymes [BR:nar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Saro_1695
DNA repair and recombination proteins [BR:nar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Saro_1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABD26135
UniProt: Q2G7N8
Position
1779469..1782000
Genome map
AA seq 843 aa AA seqDB search
MGRNDPLAAYNAKRDFARTAEPAGKRKSSATGNLFIVQKHDATRLHWDFRMEVDGVLKSW
AVTRGPSPDPDDKRLAVQTEDHPLEYARFEGIIPEGEYGGGTVMLWDKGTWEPVEGKSAK
DLEKGHLHFRLEGERMKGEWLLVRLKRRGNEKRDNWLLRKLDDAYAGQGDQLVERGLTSV
LTGRTMAEIASDKAGSHSLKGKRGKAFASVMEEAGTHNRKVGKARGKAPSRARRNAPLPA
FQPVQLATLVDTVPDGRQWLYEIKFDGYRALVAVRGTEVRVFTRSGLDWTEKFAPLARHL
AGLKLPSCLIDGEIVAADADGNPDFSRLQAVLKRGHGEQGEGDALSFHAFDLLELEGEDL
KPLPNVERKQKLAALLAGVSPPIHVADHIIGGGEKLLGALCGAGQEGIICKRADAAYAGK
RTQNWLKVKCVARQEFIVVGFTRSSARRRPFASLLLAQREGKALVYKGKVGTGFDEDLLQ
DLATRFEALKVDEGPLDVPITEARGVTWLKPELVAEIAFAEFTAEGRVRHASFVGLREDK
KAADVVPERPAPLVVQPEIVPISNRERVIFPESGQTKGDLADYYAAMAPAMLPFIANRPV
SLVRCPQGRARHCFFQKHDSGSFGEHVHHVPIREKDGNEEEYLFVSDAAGILSCVQMGTI
EFHGWCSLASDVEAPERMVIDLDPDEGLDFNDVKRAARDIRDRLSDLGLVSFAMLSGGKG
VHVVVPLRPDHTWEAHASFAERFARALALAEPDRYVATMSKARRKGRIFIDWLRNRRGST
AVMPYSARARANAPVAVPIAWEELDDFANAHPFCIGDTAGLLKRSEGKSLRGWGMAQQSL
PDV
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcaacgatccgctcgccgcctacaacgccaagcgcgacttcgcgcgcactgcg
gaacctgccggcaagcgcaagtccagcgccacgggcaatctcttcatcgtccagaagcac
gacgccacccgcctgcactgggacttccgcatggaggttgatggcgtgctcaagagttgg
gccgtgacccggggccctagccccgatcccgacgacaagcgcctcgctgtccagaccgag
gaccaccccctcgaatacgcccggttcgaaggcatcatccccgaaggcgagtacgggggc
ggcaccgtcatgctctgggacaagggcacctgggagccggtcgagggcaagagcgccaag
gatctggaaaaggggcacctccatttccgcctcgagggggagcggatgaagggcgaatgg
ctgcttgtccgcctcaagcgtcgcggcaatgaaaagcgcgacaactggctcctgcgcaag
ctggacgacgcctatgcgggccagggcgaccagctcgtcgagcgcggcctgaccagcgtc
ctcaccggccgcaccatggccgaaatcgcctccgacaaggctggcagccattcgctcaaa
ggcaagcgcggcaaggccttcgcttcggtgatggaagaagcaggcacgcataaccgcaag
gtcggcaaggcgcgcggcaaggcaccgtccagggcgcgccggaacgcaccgctacccgcc
ttccagcccgtccagctcgcaaccctggtcgatacggtgcccgatgggcgccaatggctg
tacgagatcaagttcgacggctaccgcgcgctcgtcgcagtgcggggaaccgaggtccgc
gtcttcacccgcagcggtctcgactggaccgaaaagttcgcgccgcttgcccgccatctc
gccgggctcaagctgccgtcgtgcctgatcgacggcgagatcgtcgccgccgatgccgat
ggcaatcccgatttctcgcggcttcaagccgtgctcaagcgcgggcatggcgaacagggc
gagggtgatgccttgtcgttccacgccttcgacttgctggaactcgaaggcgaagacctg
aagcccctgcccaatgtagagcgcaagcagaagctcgccgcgctgcttgccggggtctcg
ccgccgatccacgtcgccgaccacatcatcggcggcggcgaaaagctgcttggcgcgctg
tgcggcgcggggcaggaagggatcatctgcaagcgcgcggacgcggcctatgcgggcaag
cggacgcagaactggctgaaggtgaagtgcgtggcccgccaggaattcatcgtcgtcggc
ttcacccggtccagcgcccgccgccgccctttcgcctcgcttctcctggcccagcgcgag
ggaaaggcgctggtctacaagggcaaggtgggcaccggctttgacgaggacctgctgcaa
gacctcgccacccggttcgaagccctcaaggtcgacgaaggtccgctcgatgtgcccata
accgaagcgcgcggcgtgacctggctgaaacccgaactcgtcgcggaaatcgcctttgcc
gaatttaccgccgaaggccgtgtccgccacgccagcttcgtcggtctgcgcgaagacaag
aaggccgcggacgtcgtccccgaacggcccgccccgctggtcgttcagccggaaatcgtg
ccgatcagcaatcgcgagcgggtgatctttcccgaaagcggccagaccaagggcgacctt
gccgattactacgccgcgatggcgcccgcgatgctcccgttcatcgccaaccgccccgtc
agcctcgtccgctgtcctcaggggcgcgcgcgccactgcttcttccagaagcacgatagc
ggctcgttcggcgaacacgtccaccacgttccgatccgcgagaaggatggcaacgaggag
gagtatctgttcgtcagtgacgccgccggcattctctcgtgcgtgcagatgggcacgatc
gagttccacggctggtgttctctggcaagcgatgtcgaggcgcccgaacggatggtcatc
gacctcgatcccgacgaggggctcgatttcaacgacgtcaagcgcgccgcccgcgatatt
cgtgaccgcctgtccgacctcggtctcgtcagctttgccatgctttccggcggcaagggc
gttcacgtcgtcgtgccgctgcggcccgaccacacctgggaggctcacgccagctttgcc
gaacgttttgcccgcgcgctcgccctggcggaacccgatcgctacgtcgcaacgatgagc
aaggccaggcgcaagggccgcatcttcatcgactggctccgcaaccggcgcggcagcacc
gctgtcatgccctattcggcgcgcgcccgcgccaacgctcccgtcgcggtgccgatcgcc
tgggaggaactcgacgacttcgcgaacgcccaccccttctgcatcggcgatacggcagga
ctactcaagcgtagcgaaggcaagtcgctgcgcggctggggaatggcccaacagtccctc
ccggacgtttag

DBGET integrated database retrieval system