KEGG   Novosphingobium aromaticivorans: Saro_1710Help
Entry
Saro_1710         CDS       T00322                                 

Definition
(GenBank) putative transcriptional regulator, TetR family
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N
Motif
Other DBs
NCBI-ProteinID: ABD26150
UniProt: Q2G7M3
Position
1797170..1797823
Genome map
AA seq 217 aa AA seqDB search
MTFVMATLTETLTTPDRLLAGAERLVVREGVRALTVRRIAEEAGVNSALVRYHFGDTGGL
LGELALRNAAQMANERTALLDRLVPGDFMGAVDALVVPLWARAAMSRQFRAIVVLDEMFA
RSGSDLNARIWSVFADGVTRVQAALEACLPGVDPLALAWRIRFVTAAALDIPPRGLPDGR
VGARAAYGADSEEERLAHFRLFAADSLRMDKRDGYSS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgtcatggcgacgctgaccgaaaccctgaccacgcccgaccggcttctggcg
ggcgccgagaggctggtggtgcgagaaggcgtgcgcgcgctgacggtgcggcggatcgcg
gaggaggccggggtcaattcggcgctggtgcgctatcatttcggcgataccggcgggttg
ctgggcgaacttgcgcttcgcaacgccgcgcagatggcgaacgagcgaacggcgcttctg
gacaggctcgtgcccggagatttcatgggcgcggtcgatgcgctggtggtgccgctgtgg
gcgcgcgcggcgatgagcaggcagtttcgtgcgatcgtggtgctggacgaaatgtttgca
cggtccggcagcgatctcaacgccaggatatggagcgtctttgccgacggggtgacgcgg
gtgcaggcggcattggaagcctgcctgccgggcgtggacccgcttgcgctggcatggcgc
atacgattcgtgacggcagcggcgctcgacatcccgccgcgcggattgccagacggtcgc
gtgggagcccgggcggcctatggtgccgacagcgaggaggaaaggctggcccatttccgc
ctctttgccgcggactcgctgcggatggacaaacgggacggttacagttcatag

DBGET integrated database retrieval system