KEGG   Novosphingobium aromaticivorans: Saro_1717Help
Entry
Saro_1717         CDS       T00322                                 

Definition
(GenBank) alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal allergen
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
nar  Novosphingobium aromaticivorans
Brite
KEGG Orthology (KO) [BR:nar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_1717
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     Saro_1717
Exosome [BR:nar04147]
 Exosomal proteins
  Proteins found in most exosomes
   Saro_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C
Motif
Other DBs
NCBI-ProteinID: ABD26157
UniProt: Q2G7L6
Position
1804839..1805402
Genome map
AA seq 187 aa AA seqDB search
MSIVGTKLKPFQATAFHQGKFVDVSDADVVGKWGVFFFYPADFTFVCPTELEDLAGIYEE
LQGLGVEVYSVSTDTHFSHKAWHDSSPAIGKINYYMLGDQNHTISNNFGILREGVGLADR
GTFVTDPDGTIQLVEITPEGVGRNAAELLRKIKAAKYWREHPGQVCPAKWEEGAETLAPS
IDLVGKI
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgtcggaaccaagctgaagccgttccaggctaccgctttccatcagggcaag
ttcgtcgacgtcagcgacgcggacgtggtcggcaagtggggtgtgttcttcttctacccc
gccgacttcaccttcgtctgcccgaccgagcttgaagacctcgccggcatctatgaagag
ctgcagggcctcggcgtcgaagtctactcggtctcgaccgacacccacttcagccacaag
gcctggcacgacagctcgccggccatcggcaagatcaactactacatgctcggcgaccag
aaccacacgatctcgaacaacttcggcatcctgcgcgaaggcgtcggccttgccgaccgt
ggcaccttcgtgaccgacccggacggcacgatccagctcgtcgagatcacgcccgaaggc
gtgggccgcaacgctgcggaactgctgcgcaagatcaaggccgccaagtactggcgcgag
caccccggccaggtctgccctgccaagtgggaagaaggggccgaaacgcttgctccgtcg
atcgatctcgtcggcaagatctga

DBGET integrated database retrieval system