KEGG   Novosphingobium aromaticivorans: Saro_1720Help
Entry
Saro_1720         CDS       T00322                                 

Definition
(GenBank) ATPase
  KO
K06915  uncharacterized protein
Organism
nar  Novosphingobium aromaticivorans
Brite
KEGG Orthology (KO) [BR:nar00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Saro_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF87 AAA_16 TrwB_AAD_bind AAA_22 AAA_30 FtsK_SpoIIIE NACHT Zot AAA_33 Prot_ATP_ID_OB Viral_helicase1 AAA_19 RsgA_GTPase ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABD26160
UniProt: Q2G7L3
Position
1809217..1810731
Genome map
AA seq 504 aa AA seqDB search
MAPALPTLVRFARATGVSASIVIGADRSGAPVRIDVEELLATRLLVQGNSGSGKSHLLRR
LLEESASIVQQVVIDPEGDFVTLAEPFGHVVVDGSAYDGAEIAKLAARIRKHRASVILAL
DGLELEAQMRCAAVFLNTLFDAPRDEWYPALVVVDEAQMFAPAAAGDVSDEVRRLSLSAM
TNLMCRGRKRGLAGVIATQRLAKLAKNVAAEASNFLMGRTFLDIDMARAADLLGMERRQA
EAIRDLERGHFLGLGPAIARRPVGVRIADVQTHARNVVQGLMPLPNAAGAEMESILLSEP
LAMEPPPRAPEPEAPPVESGELLEQIEGFVPAAEQVEPPVAPSLFEAEETAASIAGILAE
MAAEPDCTFQPASQLYQDFTVRCRMLRILPGMDLNAFRRRFAMAVAGIFDDKEPQWQDLL
RIGKDVPDDLLAPFLTLARAAVEGAPCPDDDRLAEIYGTRSSGRIRRLLEHLEKGNLIVV
RTDYGGRRSVGIPALGLTTAPVEA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggcaccggccttgccgactctcgtgcgcttcgccagagcaaccggcgtgagcgcatca
atcgtcatcggcgccgaccggtccggcgcccctgtcaggatcgacgtcgaggagcttctt
gccacccgcctgctggtgcagggcaacagcgggtcgggcaagtcgcacctgctgcgccga
ttgctggaagaaagcgccagcatcgtccagcaggtggtgatcgaccccgagggcgatttc
gtgaccctcgccgaacctttcggccatgtcgtggtcgacggttcggcttatgacggcgct
gaaatcgccaagctggctgctcgcatccgcaagcatcgcgcctcggtcatcctcgcgctc
gacgggctcgaactggaagcgcagatgcgctgcgccgccgtgttcctcaacaccctgttc
gatgccccgcgcgacgaatggtatccggcgctggtcgtggtcgacgaagcgcagatgttc
gcccctgccgctgccggcgacgtttccgacgaagtgcgcaggctcagcctctcggccatg
accaatctcatgtgccgtgggcgaaagcgcgggctggccggcgtgatcgccacgcagcgc
ctggccaagctggccaagaacgtcgccgccgaagcgtccaacttcctgatgggccgcact
tttctcgatatcgacatggcccgcgccgccgaccttctcggcatggagcggcgccaggcc
gaagcgatccgcgatctggagcgcgggcatttcctcggcctgggccccgccattgcccgc
cgccccgtcggcgttcgcatcgcggacgtccagacgcatgcccgaaacgtggtgcaaggg
ctgatgccgctgcccaatgcggcaggcgcagagatggaatcgatcctcctgtccgaaccg
ctggcgatggaacctccaccccgcgcgccggaaccggaagcgccgccggttgagagcggc
gaattgctcgaacagatcgaaggcttcgtgcccgcagccgaacaggtcgagccgccggtc
gctccgagcctgttcgaagccgaggaaaccgcggcgagcatagcgggcattcttgccgaa
atggcggccgagcccgattgcacgttccagccggcctcgcagctctaccaggacttcacc
gtccgctgccgcatgctgcgcatcctgccgggaatggacctcaacgccttccgtcgccgc
ttcgcgatggcggtcgcgggcatcttcgacgacaaggagccgcagtggcaggacctcctg
cgcatcggcaaggacgtgccggacgacctgctcgcgccgttcctgacgctcgcccgcgcg
gcggttgagggcgcgccctgtcccgatgacgaccgtctggccgagatttacggcacccgt
tcgtctggccggattcgtcggctgctggaacacctcgagaagggcaacctcatcgtcgtg
cgcaccgattacggcgggcggcgttcggtcggcattccggcgcttgggctgaccacggcg
ccggtggaagcctga

DBGET integrated database retrieval system