KEGG   Novosphingobium aromaticivorans: Saro_1722Help
Entry
Saro_1722         CDS       T00322                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 HTH_IclR Fe_dep_repress PHZA_PHZB
Motif
Other DBs
NCBI-ProteinID: ABD26162
UniProt: Q2G7L1
Position
1811416..1811967
Genome map
AA seq 183 aa AA seqDB search
MRAGLCISCYERLPAATLTLEGRSLATAEITRQSVVPELDLDGIDGVLGLHIGTVNTLFV
SRLEKHLDPLRVTPKQVAILWLVNANPGVKQTDLSRFFQIERPTVHQFVRQLIKNSFLVN
EPSKLDRRAGGLWLTDEGREVLAKARSAIASHEDELTSCLTGREKSELFRILMKLYLLAP
AKD
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggccggcttgtgcatttcatgctatgaacggttgccggcagcaacgctaacgttg
gaaggacgttccttggccacggcagagattacccgccagtccgtcgtacccgaacttgat
ctcgacgggatcgacggcgttctgggcctccacatcggcacggtaaacacgctgttcgtt
tcgaggctggagaagcatctcgatcccttgcgcgtcacgcccaagcaggtggcgatcctg
tggctcgtcaacgcgaatccgggcgtcaagcagaccgacctttcccgcttcttccagatt
gagcggcccacggttcaccagttcgttcgccagttgataaagaacagcttcctggtcaac
gagccatccaagctcgaccggcgcgcaggggggctctggcttaccgacgagggccgcgaa
gtcctcgccaaggcgcgcagcgcgattgcctcgcacgaggatgaactgacgtcgtgcctg
accgggcgggagaagtcggagttgttccggatcctgatgaagctctaccttctcgcgcct
gccaaggactga

DBGET integrated database retrieval system