KEGG   Novosphingobium aromaticivorans: Saro_1723Help
Entry
Saro_1723         CDS       T00322                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG
Motif
Other DBs
NCBI-ProteinID: ABD26163
UniProt: Q2G7L0
Position
1812029..1812403
Genome map
AA seq 124 aa AA seqDB search
MNRLALAAILVASGMGVAVAQPAGDAVRGKAVFARCAACHDLNTGATRLGPSLKGVVGRT
SGTMPNFNYSQAMKDKAVVWNATTLDAYLAGPAKYIPGNRMAFPPLTNPQDRADLVAFLQ
QSAR
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccttgctcttgctgcaatcctcgtggcgagcgggatgggtgttgccgtggcg
cagcctgcgggcgatgccgtccgcggcaaggcggtgttcgcgcgctgcgcggcctgccac
gatctgaataccggcgcgacccgattgggcccttcgctcaagggcgttgttggccgcacg
tccggcaccatgccgaacttcaactattcgcaggcgatgaaggacaaggcggtcgtgtgg
aacgccactactctcgatgcctatctggctggccctgcgaagtacattccgggcaatcgc
atggcgttcccgccgctgaccaatccgcaggaccgcgcggacctcgtcgccttcctccag
caatccgcgcgctga

DBGET integrated database retrieval system