KEGG   Novosphingobium aromaticivorans: Saro_1728Help
Entry
Saro_1728         CDS       T00322                                 

Definition
(GenBank) transcriptional regulator, LacI family
  KO
K02529  LacI family transcriptional regulator
Organism
nar  Novosphingobium aromaticivorans
Brite
KEGG Orthology (KO) [BR:nar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nar03000]
    Saro_1728
Transcription factors [BR:nar03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    Saro_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_31 HTH_3 HTH_Crp_2 HTH_36
Motif
Other DBs
NCBI-ProteinID: ABD26168
UniProt: Q2G7K5
Position
complement(1820365..1821411)
Genome map
AA seq 348 aa AA seqDB search
MGEMNIASTSRGNAHATMEDVAKLAGVSLKSVSRVINAEPHVSAKLRAKVEAAIAELNYV
PDTAARSLAGSRAFIVGLLFDNPSPNYTMNIQKGVYETCRDQQHHLRIDNIDSTVPAEKF
EAQLAAMVRNSRCDGFVLTPPLTDNVVLLDFLDRSGIRYVRIAPDIQPDRSPGVCIDDAA
AAAAAARHLWELGHRRFAVVRGPASHGAAGRRRQGFIDELHRLGAENPIIEAEGNFSFES
GIAAGAKVLAATPRPTAIFAANDDSAAGVMVACSQAGLKVPNDVSVCGFDDSWVAKSVWP
YLTTVYQPIEEMGRAAAALLLRRDEPDNVLHELDFSLVVRASTAPPPQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaatgaacatcgcaagtacgagccgcggcaacgcacacgcaacgatggaggac
gtggcaaaactcgctggcgtctcgctaaagagcgtgtctcgcgtaatcaacgccgagccg
cacgtatcggcaaagctgagggcaaaggtcgaggcggcgattgccgaactcaattacgtt
ccggatacggcagcgcgctcgcttgccggatcgcgggctttcatcgtcggcctgctgttc
gacaaccccagcccgaactacacgatgaacatccagaagggcgtgtacgagacctgccgc
gaccagcagcaccacctgcgcatcgacaacatcgattcgacggttcccgccgaaaagttc
gaggcacaactggcggcgatggtgcgcaacagccgatgcgacgggttcgtgctaacgcct
ccccttaccgacaacgtggtgctactcgatttcctcgaccgtagcggcatccgctatgta
cgcattgcgccggacattcagcccgaccgatcgcccggggtctgcatcgatgacgcggca
gcagcagccgccgccgcgcgccacctgtgggaactggggcacaggcgctttgccgtggtg
cgcgggcccgccagccacggcgcggcgggacggcgacgccaaggcttcatcgacgagttg
cacaggctcggcgcggagaaccccatcatcgaggcggaaggcaatttcagcttcgaaagc
ggcatcgcagcgggtgcgaaggttctggcggcaaccccccgcccgaccgcgatctttgcc
gcgaacgacgattcggccgcaggcgtcatggtcgcctgctcgcaggccggactgaaagtg
ccgaacgacgtttcagtctgcggcttcgacgatagctgggtggcgaagtcggtctggccc
tatctgaccaccgtctaccagcccatcgaggagatgggccgggccgccgcggcgctgttg
ctacgccgcgacgagcccgacaatgtcctccacgaactggatttcagtctcgtcgtcagg
gcttcgacggcacccccgccccaatag

DBGET integrated database retrieval system