KEGG   Novosphingobium aromaticivorans: Saro_1738Help
Entry
Saro_1738         CDS       T00322                                 

Definition
(GenBank) DNA ligase, NAD-dependent
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar03030  DNA replication
nar03410  Base excision repair
nar03420  Nucleotide excision repair
nar03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nar00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Saro_1738
   03410 Base excision repair
    Saro_1738
   03420 Nucleotide excision repair
    Saro_1738
   03430 Mismatch repair
    Saro_1738
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nar03032]
    Saro_1738
   03400 DNA repair and recombination proteins [BR:nar03400]
    Saro_1738
Enzymes [BR:nar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     Saro_1738
DNA replication proteins [BR:nar03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     Saro_1738
DNA repair and recombination proteins [BR:nar03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     Saro_1738
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Saro_1738
   MMR (mismatch exicision repair)
    DNA ligase
     Saro_1738
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Saro_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 DNA_ligase_ZBD BRCT PTCB-BRCT HHH
Motif
Other DBs
NCBI-ProteinID: ABD26178
UniProt: Q2G7J5
Position
1832438..1834603
Genome map
AA seq 721 aa AA seqDB search
MTTSALTEAEAANELMRLARQIAKHNRLYHAEDSPEITDAEYDALVRRNAELEAAFPHLI
RPDSPSAQIGHEIAASPLGKVQHEVRMMSLDNAFTDEEVEEFVARVRRFLALPEDAEVVM
TAEDKIDGLSCSLRYENGRLVRAATRGDGQVGEDVTANVAHIPDIPQELKAAGLFDIPAV
FEIRGEVYMAKDDFLALNARQAEAGEKIFANPRNGAAGSLRQKDASVTASRPLRFLAHGW
GAASEVPAATQFEMMRKIADWGVPVSPLLVRCSSAAEMVAHYRDIGEKRASLPYDIDGVV
YKVDRLDWQDRLGFVAKAPRWGIAHKFPAERAETTLDAIDIQVGRTGKLTPVGRLKPVLV
GGVTVTNVTLHNRDEIGRLGLRVGDRIVLQRAGDVIPQVVENLTREEPRDPYHFPDHCPE
CGSEAVAEEGEVDVRCTGGLICPAQRVERLKHFVSRAALDIEGLGEKTIIEFFQLGWLES
PADIFRLRKRRSEIVGREGWKDKSVDNLLAAIEAKRQPDAARLLFGLGIRHVGAVTARDL
MKRFVTLPALREAARQASSAAREGEPANADGAYDPATVTPDSDTAGAEAGRSDALADLLS
IDGVGPVVVEALGDFFHEPHNIAVWEDLLSEVSPPPYVVETKDSAVAGKTIVFTGKLETM
SRDEAKAQAEALGARTAGSVSAKTDLVVAGPGAGSKLKQAAALGIDVIDEAAWAEIVRQA
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatcggccctcaccgaagccgaagccgccaacgagctgatgcgcctggcaagg
cagatcgcgaagcacaaccgcctctatcatgcagaggattcgcccgagatcaccgatgcg
gaatacgatgcgcttgttcgccgcaatgctgaactcgaagctgcctttccgcacctgatc
cggcccgacagcccgagcgcgcagatcgggcacgagattgccgcttcgcccctgggcaag
gtgcagcacgaggttcgcatgatgagcctcgacaatgccttcaccgacgaggaggtcgag
gaattcgtcgcgcgcgtccgccgtttcctggcgctgcccgaagatgccgaagtggtgatg
accgccgaagacaagatcgacggcttgtcctgctcgctgcgctacgagaacggcaggctg
gtccgcgccgcgacgcgcggcgatggacaggtgggcgaggacgtgaccgccaacgtcgcc
cacatcccggacatcccgcaggagttgaaagccgccgggctgttcgacatccccgccgtc
ttcgagattcgcggcgaggtctacatggcgaaggacgatttcctcgccctcaatgcccgc
caggccgaagcgggcgaaaagatcttcgccaacccgcgcaacggcgctgcgggttcgctc
cgccagaaggacgccagcgtcaccgcaagccgtcctttgcgcttcctcgcccatggctgg
ggcgcggcgagcgaagtccccgctgccacccagttcgagatgatgcgcaagattgcggac
tggggcgtacctgtctcgccgctgctcgtgcgctgttcgtccgccgccgaaatggtcgcg
cactatcgcgacattggcgagaagcgcgcttcgctgccctatgacatcgacggcgtggtc
tacaaggtcgaccggctcgactggcaggaccggctcggcttcgtcgcgaaggccccgcgc
tggggcattgcccacaagttcccggcggaacgtgccgaaaccacgctcgatgccatcgac
atccaggtcggccgcaccggaaagctgacgccggtcggccgcctcaagccggtactggtc
ggcggggttaccgtcaccaacgtcaccttgcacaatcgcgatgaaatcggccgtctgggc
cttcgcgtgggcgaccgcatcgtcctccagcgggcaggcgacgtgatcccgcaggttgtc
gagaacctcacccgcgaagaaccccgcgacccttaccactttcccgaccattgccccgaa
tgcgggtccgaagccgttgccgaggaaggcgaggtcgacgtgcgctgcaccggcggcctg
atctgcccggcccagcgcgtcgaacgcctcaagcacttcgtcagccgcgccgcgctcgac
atcgaagggctgggcgaaaagacaatcatcgaattcttccagctgggctggctcgaaagc
cccgccgatatcttccgcctcaggaagcgccgcagcgagatcgtcggccgtgaaggctgg
aaggacaagtcggtcgacaaccttctcgccgcgatcgaggccaagcgccagcccgatgcc
gcccgcctgctgttcggccttggcatccggcatgtcggtgcggtcaccgcccgggacctt
atgaaacgcttcgtcacgcttcccgctctgcgcgaagccgcccggcaagcatcgtcggcg
gcacgggaaggggaaccggcgaacgccgatggagcgtacgatccggcaacagttacgccc
gattccgacactgccggcgcggaggcgggccgatccgatgccttggccgaccttctgtcc
atcgatggcgtcggcccggtcgtggtcgaggcgctaggcgatttcttccacgaaccccac
aacatcgccgtctgggaagatctgctttccgaagtctcgccgccgccctatgtcgtcgaa
acgaaggacagtgccgtggccggaaagaccatcgtgttcaccggcaagctcgaaaccatg
agccgtgacgaagccaaggcacaggccgaggccttgggcgcgcggacggcgggctcggtt
tcggccaagaccgatctggtcgtggcggggccgggcgcaggttccaagctgaagcaggcg
gcggcgctgggcatcgatgtgatcgacgaggcggcatgggccgaaatcgtcaggcaggcg
gggtaa

DBGET integrated database retrieval system