KEGG   Novosphingobium aromaticivorans: Saro_1744Help
Entry
Saro_1744         CDS       T00322                                 

Definition
(GenBank) succinate dehydrogenase subunit C
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00020  Citrate cycle (TCA cycle)
nar00190  Oxidative phosphorylation
nar00650  Butanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01200  Carbon metabolism
Module
nar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nar_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saro_1744
   00650 Butanoate metabolism
    Saro_1744
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Saro_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABD26184
UniProt: Q2G7I9
Position
1838728..1839153
Genome map
AA seq 141 aa AA seqDB search
MAQARKARPISPHLQIWRWGPAMLVSILHRITGNGLAFAGLGLLLWWVGALASGPESYQT
FLDWVWVGSAGGIQAVTAILGKIVLVGLSWAFFQHAASGIRHLILDIGAGYELDANARWS
SLTIVISVLLTIAFWAFVLLR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggcgcgcaaagcacggccgatttcgccgcatctccagatctggcgctggggc
ccggccatgctggtctcgatcctgcaccgcatcaccggcaatggcctcgccttcgcgggc
cttgggcttctgctgtggtgggtcggtgcgctggcaagcggtccggaaagctaccagacc
ttcctcgactgggtctgggtcggcagtgccggcggcatccaggccgttaccgcgatcctc
ggcaagatcgtcctcgtcggccttagctgggccttcttccagcacgccgcctcgggcatc
cgccacctgatcctcgacatcggcgccggctacgaactggatgccaatgcgcgctggtcg
agcctgacgatcgtcatctcggtccttctcaccatcgcattctgggctttcgtgctgctg
cgctga

DBGET integrated database retrieval system