KEGG   Novosphingobium aromaticivorans: Saro_1746Help
Entry
Saro_1746         CDS       T00322                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00020  Citrate cycle (TCA cycle)
nar00190  Oxidative phosphorylation
nar00650  Butanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01200  Carbon metabolism
Module
nar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nar_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saro_1746
   00650 Butanoate metabolism
    Saro_1746
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Saro_1746
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Saro_1746
    1.3.5.4  fumarate reductase (quinol)
     Saro_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4
Motif
Other DBs
NCBI-ProteinID: ABD26186
UniProt: Q2G7I7
Position
1839579..1841393
Genome map
AA seq 604 aa AA seqDB search
MTSTQPAYKIIDHTYDTVVVGAGGSGLRATMGSAQAGLRTACITKVFPTRSHTVAAQGGI
AASLGNNSPDHWTWHMYDTVKGSDWLGDQDAIEYMVREAPAAVYELEHAGVPFSRNPEGT
IYQRPFGGHMQNMGEGPPVQRTCAAADRTGHAMLHALYQQSLKYDADFFIEYFAIDLIME
NGECRGVIALCMDDGSIHRFRSHAVVLATGGYGRSYFTATSAHTCTGDGGGMVLRAGLPL
QDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDVVSRSM
AMEIREGRGVGPHKDHIYLHLDHIDQKVLAERLPGITESGKIFAGVDLTRQPLPVVPTVH
YNMGGIPTNYHGEVVTIGADGNPETIVPGLFAVGEAACVSVHGANRLGSNSLIDLVVFGR
ATGLRLKELIKPGTAHNSLPKDSADLALTRLDHFRHAKGGSPTAEVRIEMQRTMSAHAAV
FRTDELMAEGKVKLADTYKRMEDIHVSDRSLIWNSDLVETLELDNLISQATVTMHSAHNR
KESRGAHAHEDFPDRNDAEWMKHTATWFNGWGGKGGEVRIDYRPVHEYTLTDDVEYIKPK
KRVY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgactcagcctgcctacaagatcatcgaccacacctacgacaccgtcgtcgtg
ggcgcgggcggttcgggcctgcgcgcgaccatgggttcggcccaggccggcctgcgcacc
gcctgcatcaccaaggtcttcccgacccgttcgcacaccgtggcggcacagggtggcatc
gccgccagcctcggcaacaattcgccggaccactggacctggcacatgtacgacaccgtc
aaggggtctgactggctgggcgaccaggatgccatcgaatacatggtgcgcgaggctccg
gccgcggtctacgaactggaacacgcgggtgtcccgttcagccgcaaccccgaaggcacg
atctaccagcgtccgttcggcggtcacatgcagaacatgggtgaaggcccgccggttcag
cgcacctgcgccgccgccgaccgtaccggccacgccatgcttcacgcgctgtaccagcag
agcctgaagtacgacgccgacttcttcatcgaatacttcgcgatcgacctgatcatggag
aacggtgaatgccgcggcgtgatcgcgctgtgcatggacgacggctcgatccaccgcttc
cgcagccatgcggtcgtgctggcgaccggcggctatggccgttcgtacttcaccgcgacg
tcggcccatacctgcaccggcgacggcggcggcatggtgctgcgcgcgggcctgccgctg
caggacatggaattcgtgcagttccacccgaccggcatctacggcgcgggcgtgctcatc
accgaaggcgcgcgtggtgagggcggctacctgacgaactccgagggcgagcgtttcatg
gagcgctatgccccgtcggccaaggaccttgcgtcgcgcgacgtcgtgtcgcgttcgatg
gcgatggaaatccgcgagggtcgcggcgtcggtccgcacaaggaccacatctacctgcac
ctcgaccacatcgaccagaaggtgctggcagagcgtctgcccggcatcaccgaaagcggc
aagatcttcgcgggtgtcgatcttacccgccagccgctgccggtcgtgccgaccgtgcac
tacaacatgggcggcatcccgacgaactatcacggcgaagtcgtcaccatcggcgccgac
ggcaaccccgagacgatcgtcccgggtctgttcgcggtaggcgaagcggcctgcgtttcg
gtccacggcgcgaaccgccttggctcgaactcgctgatcgaccttgtcgtgttcggccgt
gccacgggcctgcgcctcaaggaactgatcaagccgggcaccgcgcacaactcgctgccc
aaggacagcgccgacctcgcgctgacccgcctcgatcacttccgccatgccaagggcggt
tcgcccaccgccgaagtgcgcatcgaaatgcagcgcacgatgtcggcccacgcggcggtg
ttccgcaccgacgaactgatggcggaaggcaaggtcaagctggccgatacctacaagcgc
atggaagacatccacgtgtccgaccgttcgctgatctggaactcggaccttgtcgaaacg
ctcgaactggacaacctgatcagccaggcgaccgtgacgatgcattccgcgcataaccgc
aaggaaagccgcggtgcccacgcgcacgaggatttccccgatcgcaacgacgccgagtgg
atgaagcacaccgccacctggttcaacggatggggcggcaagggtggcgaagtccgcatc
gactatcgcccggtccacgaatacacgctgaccgacgacgtcgagtacatcaagccgaag
aagcgcgtgtactga

DBGET integrated database retrieval system