KEGG   Novosphingobium aromaticivorans: Saro_1760Help
Entry
Saro_1760         CDS       T00322                                 

Definition
(GenBank) Cyclopropane-fatty-acyl-phospholipid synthase
  KO
K00574  cyclopropane-fatty-acyl-phospholipid synthase [EC:2.1.1.79]
Organism
nar  Novosphingobium aromaticivorans
Brite
KEGG Orthology (KO) [BR:nar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Saro_1760
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.79  cyclopropane-fatty-acyl-phospholipid synthase
     Saro_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMAS Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS MetW PCMT Ubie_methyltran Methyltransf_32 RrnaAD
Motif
Other DBs
NCBI-ProteinID: ABD26200
UniProt: Q2G7H3
Position
1856001..1857272
Genome map
AA seq 423 aa AA seqDB search
MNAQTPLRGGHLVTGGRKLSASGRWIARAFAGSFAKALDGIDRGLDHGSIRATLPDGSIR
TLGGRGDGPAARIHLKSWNAIVRLATAGSIGWYEAWVAGEWESPDPVPIFDLFMRNADAL
GDIGRAKGPWRWGGRLLNLLRRNSKAQARRNIAAHYDLGNDFYSQWLDPTMSYSSAMWEG
IAPDASLAEAQANKVDRLGARLDLRPGSRVLEIGCGWGFLARGLAEKSGAQVTGISLSDE
QLEWARGELARSGLGGIDYLHRDYRDVEGQYDAIASVEMVEAVGREYWPSYFDCLARCLK
PGGRAALQYISMRDELFEAYASSADFIQAYIFPGGLLISEREFARLAAERGLTWQDRTDF
GQDYARTLRLWREALDTAVEEGRLPPGFDQRFVDLWRYYLMYCEGGFRGGGINVSQVTLV
KAG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctcagacgccactgaggggagggcatctggtcaccggcggacgaaaactgtcg
gcgtccggtcgctggatcgcgcgcgcgttcgccggctcgttcgccaaggcgctggacggg
atagaccgggggctggaccacggctccatacgcgcgactctgcccgatggaagcattcgc
acgcttggcgggaggggagacggtccggccgcgcgcattcacctgaagagctggaacgca
atcgtccggctcgccacggcaggctccattggctggtatgaggcctgggtcgcgggtgaa
tgggaaagtcccgacccggtcccgatcttcgacctgttcatgcgtaatgccgacgcgctg
ggcgacatcgggcgggccaagggcccatggcggtggggagggcggctgctcaatctcctg
cgccgcaattcgaaggcgcaggcgcgccgcaacatcgccgcgcactacgatcttggcaac
gacttctattcgcagtggctcgacccgacgatgagctattcgagcgcgatgtgggagggc
atcgcgcccgacgcctcacttgccgaggcccaggcgaacaaggtcgaccggcttggcgcc
cgtctcgacctgcggccgggatcgcgcgtgctcgagatcggatgcggatggggcttcctc
gcccgcgggcttgccgagaagagcggcgcgcaagttaccggcatcagtctctcggacgag
cagctcgaatgggcgcgtggcgaattggcgcgctcgggcctcggcggaatcgattacctt
caccgggactaccgggatgtcgaaggccagtacgatgccattgccagcgtcgagatggtc
gaggccgtgggccgcgaatactggccgtcctacttcgattgcctcgcgcggtgcctgaag
ccgggcggtcgagccgcgctgcaatacatttcgatgcgcgacgagttgttcgaggcctat
gcgtcgagcgcggacttcatccaggcctacatctttcctggcggcctgctcatcagcgag
cgcgagttcgcacgccttgccgcagagcgcggccttacctggcaggaccggacggacttt
ggccaggactatgcccgaacgcttcgcctgtggcgcgaggcactggacacggcggtggag
gaagggcgtctgccgcccggcttcgaccagcgtttcgtcgacttatggcgctattacctg
atgtattgcgaaggtggctttcgcggcggcgggatcaatgtcagccaggtgacgctggtc
aaggccggctag

DBGET integrated database retrieval system