KEGG   Novosphingobium aromaticivorans: Saro_1762Help
Entry
Saro_1762         CDS       T00322                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 RmlD_sub_bind THF_DHG_CYH_C ApbA
Motif
Other DBs
NCBI-ProteinID: ABD26202
UniProt: Q2G7H1
Position
complement(1857722..1858453)
Genome map
AA seq 243 aa AA seqDB search
MSAQGSQDGRFAGQLALVTGASRGIGAATAKALAAQGAHVVLVARTAKELEKVEEEIFEA
GGSATIAPVDLSEPEGIARLATAISGRWSALDVLVINAAAFPTLTPVWQIDSREFNNALT
LNVLATQALLAGFDGMLKKSKDARVIGVTSSVGATPRAYWGAYGASKAAFDVLLDCYAQE
VRNTSAVRVAILDPGATRTKMRARAYPGENPESVKAPEVVAERMVALLGEQFSSPHRERV
NQD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcagggttcgcaggacggccgctttgccggccagttggcgctcgtcaccggc
gcgagccggggcatcggtgccgccacggcaaaggcgcttgccgcacagggcgcgcatgtc
gtactcgtggcccggaccgccaaggagcttgaaaaggtcgaggaagagatcttcgaggct
ggcggcagcgcgacgatcgctccggtcgacctgtccgagcccgaaggcatcgcccgcctt
gccaccgcgatctcgggccgctggagcgcgctcgacgtactcgtcataaacgccgccgcc
ttccccacgctgacaccggtctggcagatcgactcgcgcgagttcaacaatgcgctgacg
ctgaacgtcctcgccacgcaggcgctgctcgccggtttcgacggcatgctgaagaagagc
aaggacgcccgcgtcatcggcgtgaccagcagcgtcggcgcgacgccgcgcgcctactgg
ggcgcctatggcgcgtcgaaggccgcgttcgacgtcctgctcgactgctacgcgcaggaa
gtgcgcaacacctcggccgtgcgcgtcgcaattctcgatccgggcgccacgcgcaccaag
atgcgcgcaagggcctatcccggcgaaaacccggaaagcgtgaaggcgcccgaagtcgtt
gccgaacgaatggttgcgcttcttggtgaacaattttccagtccgcaccgcgaacgcgtt
aaccaggactga

DBGET integrated database retrieval system