KEGG   Novosphingobium aromaticivorans: Saro_1763Help
Entry
Saro_1763         CDS       T00322                                 

Definition
(GenBank) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00230  Purine metabolism
nar00250  Alanine, aspartate and glutamate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01130  Biosynthesis of antibiotics
Module
nar_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Saro_1763
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Saro_1763
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nar01002]
    Saro_1763
Enzymes [BR:nar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     Saro_1763
Peptidases [BR:nar01002]
 Cysteine Peptidases
  Family C44
   Saro_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 Pribosyltran GATase_4 PRTase_2 PDZ
Motif
Other DBs
NCBI-ProteinID: ABD26203
UniProt: Q2G7H0
Position
complement(1858454..1859944)
Genome map
AA seq 496 aa AA seqDB search
MTSQNELFDSTPWDIGSDDDKLREECGIFGVLGVRDAAATVALGLHALQHRGQEAVGITS
FDGQEFYSRKGIGHVAANFSTGSAIAELPGAMAAGHVRYSTTGGAGLRNVQPLFADLASG
GFAIAHNGNISNAMFLKRDLVQKGAIFQSTSDTEVIIHLVATSRYPTLLDRFVDALRLVE
GAYSLICMTPEGMIACRDPLGIRPLVLGKIGDAVVFASETVALDVVGAEFVREVEPGELV
QVDFDGKLSSHRPFGRPSARPCIFEHVYFSRPDSLMGGNSVYQVRKAIGAQLAIESPADA
DLVIPVPDSGVPAALGYAQQSGIPFELGIIRSHYVGRTFIQPSDGARNADVKRKHNANRA
LVAGKRIVLIDDSIVRGTTSLKIVQMMRDAGAAEVHMRIASPPTEHSCFYGVDTPERSKL
LAARMDVQAMADFIHADSLAFVSIDGLYRAVGEEQRNKGCPQYCDACFTGDYPTRLTDLA
ERENPDQLSLPVEKVA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacagaacgaacttttcgacagcacgccgtgggacatcggcagtgacgacgac
aagctgcgcgaagagtgcggcatcttcggcgtactgggcgtacgtgacgccgccgcgaca
gttgcactgggcctccacgccctgcagcatcggggccaggaagccgtcggcatcaccagt
ttcgacgggcaggagttctattcgcgcaagggcatcggccacgtcgcggcgaacttctcg
accggctcggccatcgccgaactgccgggcgccatggccgccggccacgtgcgctactcg
accaccggcggggccggcctgcgcaacgtgcagccgctgtttgccgacctcgcgtcgggc
ggcttcgcgatcgcccacaacggcaacatctcgaacgcgatgttcctcaagcgcgacctc
gtgcagaagggcgcgatcttccagtcgacgtccgacaccgaagtcatcatccacctcgtc
gcgacgagccgctaccccaccctgctcgaccgcttcgtcgatgccctgcggctggtcgaa
ggcgcctattcgctgatctgcatgacgcccgaaggcatgatcgcctgccgcgacccgctt
ggcatccgcccgctggtcctcggcaagatcggcgacgcggtggtcttcgcgagcgaaacc
gtggcgcttgacgtggtcggcgccgaattcgtccgcgaagtggagccgggcgaactggtc
caggtcgatttcgacggcaagctcagcagccaccgcccgttcggcaggccaagcgcgcgg
ccctgcattttcgagcacgtctacttcagccgtcccgattcgctgatgggcggcaattcc
gtctatcaggtgcgcaaggccatcggcgcgcagctcgccatcgaaagcccggccgacgcg
gacctcgtcatccccgtgccggacagcggcgttcccgccgcgcttggctatgcccagcag
tccggcattccgttcgagcttggcatcatccgctcgcactatgtcggccgcaccttcatc
cagccttccgacggtgcccgtaacgcagacgtgaagcgcaaacacaacgcgaaccgcgca
ctggtcgcggggaagcgcatcgtgctgatcgacgattcgatcgtgcgcggcaccaccagc
ctcaagatcgtgcagatgatgcgcgacgcgggtgcggcagaagtgcacatgcgcatcgcc
agcccgccgacggagcattcgtgcttctacggcgtcgacacgcccgaacgctcgaagctg
ctcgccgcgcggatggacgtgcaggccatggccgacttcatccatgccgacagcctcgcc
ttcgtctccatcgacggtctctaccgcgcggtcggcgaggagcagcgcaacaagggctgc
ccgcaatattgcgacgcctgcttcaccggcgactaccccacgcggctgaccgacctcgca
gagcgcgagaatccggaccagctttcgctgccggtcgaaaaggtcgcctga

DBGET integrated database retrieval system