KEGG   Novosphingobium aromaticivorans: Saro_1770Help
Entry
Saro_1770         CDS       T00322                                 

Definition
(GenBank) DNA polymerase III, alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00230  Purine metabolism
nar00240  Pyrimidine metabolism
nar01100  Metabolic pathways
nar03030  DNA replication
nar03430  Mismatch repair
nar03440  Homologous recombination
Module
nar_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Saro_1770
   00240 Pyrimidine metabolism
    Saro_1770
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Saro_1770
   03430 Mismatch repair
    Saro_1770
   03440 Homologous recombination
    Saro_1770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nar03032]
    Saro_1770
   03400 DNA repair and recombination proteins [BR:nar03400]
    Saro_1770
Enzymes [BR:nar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Saro_1770
DNA replication proteins [BR:nar03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Saro_1770
DNA repair and recombination proteins [BR:nar03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Saro_1770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_alpha HHH_6 PHP HHH_3 COE1_HLH DUF655
Motif
Other DBs
NCBI-ProteinID: ABD26210
UniProt: Q2G7G3
Position
1864289..1867936
Genome map
AA seq 1215 aa AA seqDB search
MKKQAAPLARARPFSYLVHMPHAAFVPLRIFSSYTMLDGAIDPKAIAKTAAERGFPAAAI
TDRNGLYGSVAYAKACKDMGVQPVIGTMLAVARPERDGAATGFGPAAPTIDWLALYAQDA
RGYDNLCHLVSRAHLDRPLEFAPHVVLADLVGHTDGLICLTAASEGALAQLLAGGQQSAA
EAYVDRLLELFPERLYIEIARRNDAVEEASETALIDLAYARDLPLVATNPACFAERTFYD
AHDAMLCIASSTHVDSADRPRSSKEWWIKPAAVMEELFKDLPEALANTLVVAQRCAVMPP
KRKPILPSLAGDQEGEARMCAEDSRKGLVLRLEPYYPESTHAELARVLCLGPDAEPVAAD
HPQLVEAGVWEEVLDYRKRLEFEIAIINRMGFGGYFLIVADFIKWAKEHGIPVGPGRGSG
AGSLVAWALTITDLDPIKLGLLFERFLNPERVSMPDFDIDFCETRRGEVIRYVQRKYGED
HVAQIITFGKLKARAVLRDTGRILQMSYGQTDRLCKMVPNHPTDPWPLPRALNGVAELKR
EYDRDPEVKRLIDLAMQLEGLPRNSSTHAAGVVIGDRPLAQLVPLYRDPRSDMPVTQFDM
KHVEDAGLVKFDFLGLKTLSVLRKAVDLMKKRSIEIDLSALPWDDEQTYKLLQSGDTVGV
FQLESEGMRRTLAAVKPTNFGDIIALVSLYRPGPMDNIPLFGRRKNGLEAIEYPHDKLAG
ILSETYGIFVYQEQVMQAAQILAGYSLGDADLLRRAMGKKVQAEMDAQRQRFVDGCKEVS
GIPAAKANELFDLIDKFAGYGFNKSHAAAYALLAYQTAWLKTHYPHEFYAAAMCFDMHQS
EKLSVFVDDMRRNGVALAGPDINHSEAEFTVERTHDGYAVRYALAGLRNVGEKAMEQIVE
EREANGPFASLDDLFRRIPAGSMNRRQLEALAAGGALDCLEPNRAQIIANAELLMAVAEE
ASRSRTSGQGGLFGGDDHATPATRLSDTKPWSRADQMAAERENFGFYFAAHPVEEYRAVA
SANGARSYGSLMTSSGEPGGRSGAVMAALVENVQKRKTKKGKDFVMADFSDSSGLFSASC
FEESLVEPFQQWAREGTCVLLNVELDRPNPDEPPRVTVRGARPLASVTSASRMVLKLDVS
RTEAISDLAMLLPRRPDGKGEVLARLRTGGPKEPLVRLGNDFILDSDLIERLIPIEGLAN
VALTARPERHLRLVE
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagcaggccgcgcctctcgcaagagcgcggcctttttcctaccttgtacacatg
ccccatgccgccttcgtcccgcttcgcatcttctcgtcctacacgatgctcgacggcgcc
atcgacccgaaggctatcgccaagaccgccgccgagcggggctttcccgccgccgccatc
acagatcgcaacgggctctacggtagcgtggcctatgccaaggcgtgcaaggacatgggc
gtccagccggtcatcggcacgatgctcgccgtagcccgtcccgaacgcgacggcgcggca
accggcttcggtccggccgcaccgacgatcgactggctggccctctatgcgcaggatgcc
aggggctatgacaacctttgccacctcgtcagccgcgcccatctcgaccggccgctcgaa
tttgcgccgcacgtcgtcctggcggatctcgtcggccataccgacggcctcatctgcctt
accgccgccagcgaaggcgcactggcgcagcttcttgccggaggccagcaaagcgccgcc
gaggcctatgtcgaccggctgctcgaactgttccccgaacggctctacatcgagatagcc
cggcgcaacgatgcggtggaggaagcgtccgaaaccgcgctcatcgatctcgcatacgcg
cgggacctgccgctggttgccacgaaccccgcctgctttgcagagcggactttctacgat
gcgcacgatgccatgctctgcatcgccagttccacccatgtcgatagcgcggatcgcccg
cgctccagcaaggaatggtggatcaagcccgcggcggtcatggaggaactgttcaaggac
ctgcccgaagcgctcgccaacacgctggtcgtggcgcagcgctgcgcggtcatgccgccc
aagcgcaagccgatcctgcccagccttgccggcgaccaggaaggcgaggcgcggatgtgc
gccgaggatagccgcaagggcctcgtcctgcgacttgaaccctattacccggaaagcacc
cacgccgaactcgctcgcgtgctctgccttggccccgatgccgaaccggtcgccgccgac
catccgcaactggtcgaagcgggcgtctgggaagaagttctcgactaccgcaagcggctc
gagttcgagatcgcgatcatcaaccgcatggggttcggcggctacttcctgatcgttgcc
gactttatcaagtgggcgaaggaacacggcattccggtcgggccgggccgcggttcgggc
gcgggttcgctcgtcgcttgggcgcttaccatcaccgacctcgatccgatcaagcttggt
cttctgttcgaacgcttcctgaatccggaacgcgtctcgatgccggacttcgacatcgac
ttctgcgaaacccgccgtggcgaggtgatccgctacgtccagcgcaagtacggcgaggac
cacgtcgcccagatcatcaccttcggcaagctcaaggcccgcgcggtgctgcgcgacacc
ggccgtatccttcagatgagctatggccagactgaccggctctgcaagatggtcccgaac
catccgaccgatccctggccgctgccccgcgccctcaatggcgtggccgaactcaagcgc
gaatacgaccgcgaccccgaggtcaagcgcctgatcgaccttgcgatgcagctcgaaggc
ctgccgcgcaacagttcgacccacgcggcgggcgtcgttatcggcgaccgcccgctggcg
caactcgtgccgctctatcgcgatccgcgttcggacatgccggtcacgcagttcgacatg
aagcacgtcgaggatgccggcctcgtcaagttcgacttcctcggcctcaagacgctgtcg
gtcctgcgcaaggccgtagacctgatgaagaagcgcagcatcgagatcgacctctcggcg
ctgccgtgggacgacgagcaaacctacaagctgctccagtcgggcgacaccgtcggcgtt
ttccagctcgaatccgaaggcatgcggcgcacgctcgccgcggtgaagcccaccaacttc
ggcgacatcatcgctctcgtctcgctttaccgtccgggcccgatggacaacataccattg
ttcggccgccgcaagaacgggctcgaagcgatcgagtatccgcacgacaagctggccggg
atcctgtcggaaacctacggcatcttcgtctaccaggaacaggtcatgcaggccgcgcag
atcctcgccggatactcgctcggcgacgccgacctcctgcgccgcgccatgggcaagaag
gtccaggcggaaatggacgcgcagcgccagcgtttcgtcgacggctgcaaggaagtgtcc
ggcattcccgccgcaaaggccaacgaacttttcgacttgatcgacaagttcgcgggctac
ggcttcaacaagtcgcacgcagccgcctacgcgctgctcgcctaccagaccgcctggctc
aagacgcactatccgcacgaattctatgcggcggcgatgtgcttcgacatgcaccagtcg
gaaaagctctcggtcttcgtcgacgacatgcgccgcaacggcgtggcgctggccgggccc
gatatcaaccactccgaggccgagttcaccgtcgagcggacgcacgacggctatgccgtg
cgatatgccctcgcgggcctgcgcaacgtgggcgagaaggcgatggagcagatcgtcgag
gagcgtgaggccaacggcccgttcgcttcgctggacgatctcttccgccgcatcccggcg
ggttcgatgaaccgtcgccagctcgaagcgctcgcggccggtggcgcgctcgattgcctc
gagcccaaccgcgcgcagatcatcgccaatgccgaactgctcatggccgtggccgaggag
gcctcgcgctcgcgcacttcggggcagggcggccttttcggcggcgacgatcacgccact
cccgccacccgcctctccgacacgaaaccgtggagccgcgcggaccagatggcggcggag
cgcgagaatttcggcttctactttgccgcgcacccggtcgaggaataccgcgccgtcgcc
tcggccaatggtgcgcgctcctatggcagcctgatgacgagcagtggggagccgggcgga
cgctcgggcgccgtcatggccgcgctggtggagaacgtgcagaagcgcaagacgaagaag
ggcaaggacttcgtcatggccgacttctccgacagctccggcctgttctcggcctcctgc
ttcgaggaaagcctggtcgaaccgttccagcagtgggcgagggaggggacctgcgttctc
ctcaacgtcgaactcgaccgccccaatccggatgagccgccgcgcgtcaccgtgcgcggc
gcccgcccgctcgcctcggtcaccagcgcctcgcgcatggtgctcaagctcgatgtcagc
aggacggaggcgatttccgacctcgcgatgctcttgccgcggcggcctgacggcaagggc
gaggtgcttgcccgccttcgtaccggcgggccaaaggagcctctcgtgcgcctcggcaat
gatttcatactcgatagtgacttaatcgaacgattgattccgatagaaggactcgccaat
gtggcattgaccgcaagaccggaaaggcatctgcggttggtcgaatag

DBGET integrated database retrieval system