KEGG   Novosphingobium aromaticivorans: Saro_1775Help
Entry
Saro_1775         CDS       T00322                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07664  two-component system, OmpR family, response regulator BaeR
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar02020  Two-component system
Module
nar_M00450  BaeS-BaeR (envelope stress response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_1775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:nar02022]
    Saro_1775
Two-component system [BR:nar02022]
 OmpR family
  BaeS-BaeR [MD:M00450]
   Saro_1775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABD26215
UniProt: Q2G7F8
Position
1872681..1873412
Genome map
AA seq 243 aa AA seqDB search
MNLQPSQRLVYVVEDDVRIASVLSDYLTAEGFLPRWFSDPLVALASARSQPPALVLLDIM
LPGIDGLAFCHRLRAFCDCPIIMLTARISTEDKVAGLSAGADDYVVKPFSPGEVMARVHA
HLRRAEGRLAAAARNGGYVIDEAGMRISWKGQWLDLSLAEYAVASALMRQPERSFTRGQL
LDSLLAVLGERTLETSERAVDSHIKNIRRKILAIDPGGACIATVYGLGYRFSVGLKAEGE
RRG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacctccagccatcccagcgccttgtctatgtggtcgaggacgatgtccggatcgct
tcggttctcagcgattacctgacagcggaaggtttcctgccccgctggttctccgatcct
ctggttgcgctcgcatctgcgcggagccaacccccggcgctggtcctgctcgacatcatg
cttccaggcatcgacgggcttgcgttctgccacaggctgcgcgcattctgcgattgcccc
atcatcatgctgaccgcccgcatttcaaccgaggacaaggtagccgggctttccgccggg
gccgacgactacgtggtgaagcccttcagtcccggcgaagtcatggcgcgggtccatgcg
cacttgcgccgggcggagggacggcttgcggcggccgcgcgcaatggcggatatgtgatc
gacgaggccgggatgcgtatttcctggaagggccaatggctcgatctctcgcttgcggag
tatgccgtggcatcggcgttgatgcggcaacctgagcggagcttcacgcgcgggcagctt
ctggacagcttgctcgccgtcctaggcgaacgcacgctcgagacgtcggagcgagccgtc
gacagccatatcaagaacattcggcgcaagatcctggcgatcgatccgggcggggcctgc
atcgcaaccgtctatggcctgggctaccgcttcagcgtcggcctgaaagcagaaggagaa
cggcgaggatag

DBGET integrated database retrieval system