KEGG   Novosphingobium aromaticivorans: Saro_1779Help
Entry
Saro_1779         CDS       T00322                                 

Definition
(GenBank) Lytic transglycosylase, catalytic
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT
Motif
Other DBs
NCBI-ProteinID: ABD26219
UniProt: Q2G7F4
Position
complement(1875794..1877572)
Genome map
AA seq 592 aa AA seqDB search
MKLARAAHCSLAALATCFAVLGAVPANANSAAVDYFRGRADRTAVPSLLSQDDRSFYKSL
FGAIEREEWTQVQALFAQRADGPLHDVARSQYMLAATSPKAELGALTDVLNRAPNLPWAE
QLGRLALKRGASELPALPQGQRLVSLPSVSKRIRPRSITDGSMPDAVSAAIMDRIKFDDP
VGARVLLDGVDATLSPEARTEWRQKIGWAFYIENDDATARAIALSAAEGGAGPWVSEAHW
TAGLASWRLGDCMAAAESFERTAALAHNEELASAANYWASRAWLRCRKPEKVSGALRSAA
RYRDTLYGMMASEALGLRDSQPAAAPDFSQADWQQLRDVPNIRTAVQLAEIGEDGLADEI
LRHQARIGAPGQYAPLSRLARDLGLPSTQLWMAYNAPSGARPDEAARFPAPKWTPATGWK
VDPALLFAHSLQESNFRTAVTSPAGAKGLMQVRPGTARDMARVEPLMAGRDRQLDLPDVN
LAFGQQYLQQLRDAEATQGLLPKVMAAYNAGPLPVARWNTEIRGGSDPLLWMESIPYWET
RGYVAIVMRNYWMYERQAGGPSDSRLGLVQGMWPKFPGLAGADNVRIASRGN
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggctcgcgccgctcattgctcgctcgcagcgctggcgacctgcttcgccgtg
ctgggcgccgttccggccaatgccaacagcgccgccgtcgactatttccgtggccgggcg
gaccgtaccgccgtgccctcgctgctcagccaggacgaccgctcgttctacaagtcactg
ttcggcgcgatcgagcgagaagaatggacccaggtccaggccctgttcgcacagcgtgcc
gacggcccgctgcatgacgttgcccgcagccagtacatgctcgccgcaacctcgcccaag
gccgaactcggcgcgctgaccgacgtgctgaaccgcgcgccgaacctgccttgggccgaa
cagcttggccgcctggcgctcaagcgcggggcgagcgagcttcccgccctaccgcagggt
cagcgcctggtttcgctgcccagcgtatcgaagcgtatccgcccgcgctccatcaccgac
ggctccatgcccgatgcagtctctgccgcgatcatggaccgcatcaagttcgacgatccg
gtcggagcgcgcgtgctgctcgacggcgtcgacgccaccctttcgcccgaagcgcggacc
gaatggcgccagaagatcggctgggccttctacatcgagaacgacgacgcgaccgcccgc
gccattgcgctttcggctgcggaaggcggcgcggggccttgggtatccgaggcgcattgg
accgcaggccttgcgagctggcgccttggcgattgcatggccgctgcggaatccttcgaa
aggactgccgccctcgcccacaacgaggaactcgcctcggccgcgaactactgggcaagc
cgcgcctggctgcgctgccgcaagcccgagaaggtttccggcgccctgcgctctgccgcg
cgataccgcgacacgctctacggcatgatggccagcgaggcgctcggcctgcgcgatagc
cagcccgccgccgcccccgatttctcgcaggcggactggcagcaattacgcgacgttccc
aacatccgcaccgccgtccagcttgccgagatcggcgaggacgggctcgcggacgagatc
ctgcgtcatcaggcgcgcatcggtgcgccgggccagtacgccccgctctcgcggcttgcc
cgcgacctcggcctgccctcgacccagctctggatggcgtacaacgcgccttcgggtgcc
cggcccgacgaagccgcccgcttccccgcgcccaagtggaccccggcaaccggctggaag
gtcgacccggcgctcctcttcgcccattcgttgcaggaatcgaacttccgcaccgccgtt
accagcccggccggcgccaagggcctcatgcaggtgcgccccggcaccgcgcgcgacatg
gcccgcgtggaaccgctcatggccgggcgcgatcgccagctcgacctgccggacgtgaac
ctcgcgttcggccagcagtatctccagcagctccgcgatgccgaggccacgcaaggcctg
ctgcccaaggtcatggcggcctacaacgccgggccgctgccggtggcgcgctggaacacc
gagatccgtggcggcagcgatccgctgctgtggatggaatcgatcccctactgggaaacg
cgcggctatgtggccatcgtcatgcgcaactactggatgtacgaaaggcaggcgggcggc
ccgtccgacagccggctcggcctcgtccagggcatgtggccgaagttcccgggccttgcg
ggagcggacaacgtaaggatcgcttcgcgtggcaattga

DBGET integrated database retrieval system