KEGG   Novosphingobium aromaticivorans: Saro_1784Help
Entry
Saro_1784         CDS       T00322                                 

Definition
(GenBank) dihydroxyacid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00290  Valine, leucine and isoleucine biosynthesis
nar00770  Pantothenate and CoA biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01130  Biosynthesis of antibiotics
nar01210  2-Oxocarboxylic acid metabolism
nar01230  Biosynthesis of amino acids
Module
nar_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
nar_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Saro_1784
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Saro_1784
Enzymes [BR:nar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     Saro_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: ABD26224
UniProt: Q2G7E9
Position
1881817..1883664
Genome map
AA seq 615 aa AA seqDB search
MPAYRSRTTTHGRNMAGARGLWRATGMKDSDFGKPIIAVVNSFTQFVPGHVHLKDLGQMV
AREIEAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDLIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMAAMRINIPVVFVSGGPMEAGKVILKGKEHALDLVDAMVAAADESFTDEE
VTAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTLATHADRQRLFLEAGRLVV
DLCKRYYEQDDESVLPRSIATFEAFENAMSLDIAMGGSTNTVLHLLAAAHEAGVNFTMSD
IDHLSRKVPCLSKVAPAKSDVHMEDVHRAGGIYAILGELDRAGLLHTHLPTVHSRTLGDA
LNQWDVKRTNSPTVQEFFRAAPGGVPTQVAFSQDRRWKELDLDRETGVIRSAEHAFSKDG
GLAVLFGNIAREGCIVKTAGVDDSILKFTGPAKVYESQDAAVTAILTGQVTSGDVVVIRY
EGPKGGPGMQEMLYPTSYLKSKGLGAACALLTDGRFSGGTSGLSIGHVSPEAAEGGEIGL
VENGDVIEIDIPNRTIHLAVADDVLAQRRAEQEAKGWKPVKERPRKVSTALRAYAAMTTS
AARGAVRDLSQLKID
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcctatcgttcgcgcacgaccacccacggccgcaacatggcaggtgcacgcggc
ctctggcgcgctaccggcatgaaggacagcgatttcggcaagccgatcatcgccgtcgtg
aactcgtttacccagttcgtccccggccacgtccacctcaaggacctgggccagatggtc
gcccgcgaaatcgaagcagcgggcggcgtcgcgaaggaattcaacaccatcgcggtcgac
gatggcatcgccatgggccatgacggcatgctctattcgctgcccagccgcgatctgatc
gccgacagcgtcgaatacatggtcaacgcccattgcgccgacgcgatggtctgcatctcc
aactgcgacaagatcacccccggcatgctcatggcggcaatgcggatcaacatcccggtg
gtcttcgtgtccggcggcccgatggaggccggcaaggtcatcctcaagggcaaggaacac
gcgctcgacctcgtcgatgcgatggtcgccgccgcagacgaaagcttcaccgacgaggaa
gtgaccgccatcgagcgttcggcctgcccgacctgcggttcgtgctcgggcatgttcacc
gccaattcgatgaactgcctgaccgaggcgcttggactttcgctgcccggcaacggatcg
acccttgccacccacgccgatcgccagcgcctgttcctcgaagcaggccgcctcgtggtc
gacctgtgcaagcgctactacgagcaggacgacgaaagcgtcctgccgcgttcgatcgcc
acgttcgaggctttcgagaacgcgatgagcctcgacatcgcgatgggcggttcgaccaac
accgtgctgcatctgctggccgccgcgcacgaggcgggcgtcaacttcaccatgtccgac
atcgaccatctcagccgcaaggtgccgtgcctgtcaaaggtcgctccggcaaagtccgat
gtgcacatggaagacgtccaccgcgcaggtggcatttatgccatcctcggcgaactggac
cgcgcgggcctgcttcatacccatctgccgaccgtccacagccgcacgcttggcgatgcg
ctgaaccagtgggacgtgaagcgcaccaactcgcccacggtgcaggaattcttccgcgcc
gcgccgggcggcgtgccgacgcaggttgccttctcgcaggatcgccgctggaaggaactc
gatctggaccgcgaaacgggcgtgatccgttcggccgagcatgcgttctcgaaggacggc
ggccttgccgtgctgttcggtaacatcgcccgcgagggttgcatcgtgaagaccgcgggc
gtggacgacagcatcctgaagttcaccggtccggcaaaggtctatgaaagccaggatgcc
gccgtcaccgcgatcctcaccgggcaggtgacctcgggcgacgtggtcgtgatccggtac
gaagggcccaagggcggccccggcatgcaggaaatgctctatccgacgagctacctgaag
tcgaagggcctgggtgcggcctgcgcgctgctgaccgatggccgtttctcgggcggcacg
tcgggcctgtccatcggccacgtctcgccggaggctgccgagggcggggagatcggtctg
gtcgagaacggcgacgtgatcgagatcgacattccgaaccgcaccatccaccttgccgtg
gcggacgatgtccttgcccagcgccgggcggagcaggaggcgaagggctggaagccggtc
aaggaacgcccgcgcaaggtgtcgaccgcgctcagggcctatgccgcgatgaccaccagc
gcggcgcgcggtgcggtgcgcgatctttcgcaactcaagatcgactga

DBGET integrated database retrieval system