KEGG   Novosphingobium aromaticivorans: Saro_1790Help
Entry
Saro_1790         CDS       T00322                                 

Definition
(GenBank) carboxynorspermidine dehydrogenase
  KO
K00290  saccharopine dehydrogenase (NAD+, L-lysine forming) [EC:1.5.1.7]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00300  Lysine biosynthesis
nar00310  Lysine degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01130  Biosynthesis of antibiotics
nar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Saro_1790
   00310 Lysine degradation
    Saro_1790
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.7  saccharopine dehydrogenase (NAD+, L-lysine-forming)
     Saro_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sacchrp_dh_C Sacchrp_dh_NADP KR Shikimate_DH Epimerase GDP_Man_Dehyd Ldh_1_N AlaDh_PNT_C ThiF
Motif
Other DBs
NCBI-ProteinID: ABD26230
UniProt: Q2G7E3
Position
1887709..1888914
Genome map
AA seq 401 aa AA seqDB search
MAKVLVIGAGGVGSVAVHKMAMNADIFTGIALASRTKSKCDAIAASVKERTGVTVDTYQI
DADDVAATTALINEVKPVLVVNLALPYQDLHIMDACLAAGVNYMDTANYEPIDEAKFEYS
WQWAYQDKFKQAGLMALLGSGFDPGVTSVFATWLKKHKLDTIRTLDILDCNGGDHGQHFA
TNFNPEINIREVTAPARHYLKGEWVETPALTIRHQFDFEEVGPKNMYLMYHEELESLAKH
LPEIERIRFWMTFGDAYITHLTVLQNVGMTRIDPVMYEGKEIIPLQFLKAVLPEPASLGP
TTKGKTNIGDIATGLKDGVEKTFYIYNICDHEDAYRETGNQAVSYTTGVPAMIGAAMMVQ
GIWSGEGVFNIEQFDPDPYMDMLNKHGLPWQVKELAGPLEF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttctcgtcatcggcgcaggcggcgtcggctcggttgcggtccacaagatg
gcgatgaatgccgatatcttcacgggcatcgcgctcgccagccgcacaaagtcgaagtgc
gacgccattgccgcctcggtgaaggagcgcaccggcgtcaccgtcgacacctaccagatc
gatgcagacgacgtcgccgcgacgaccgcgttgatcaacgaggtcaagcccgtcctcgtc
gtcaatctcgcgctgccctaccaggacctgcacatcatggacgcctgccttgccgccggc
gtcaactacatggataccgcgaactacgagccgatcgacgaggcgaagttcgagtattcg
tggcagtgggcctaccaggacaagttcaagcaggcaggcctcatggccctgctcggttcg
ggcttcgatccaggcgtgaccagcgtcttcgccacctggctcaagaagcacaagctcgac
acgatccggacgctcgacattctcgactgcaacggcggcgatcacggccagcatttcgcc
accaacttcaacccggaaatcaacatccgcgaagtgaccgcgcctgcgcgccactacctg
aagggtgaatgggtcgaaacgcctgccctgaccatccgccatcagttcgacttcgaggaa
gtcggccccaagaacatgtacttgatgtaccacgaggaactcgaaagcctcgccaagcac
ctgcccgagatcgagcgcatccgcttctggatgacgttcggcgatgcctacatcacgcac
cttaccgtgctgcagaacgtgggcatgacccgcatcgacccggtcatgtacgagggcaag
gagataatcccgctccagttcctcaaggccgttctgcccgaaccggccagcctcggcccg
acgaccaagggcaagacaaacatcggcgacatcgccaccggtctcaaggatggcgtcgag
aagaccttctacatctacaacatctgcgaccacgaggacgcctaccgagagaccggcaac
caggcggtcagctatacgaccggcgtgcccgcgatgatcggtgccgcgatgatggtgcag
ggcatctggtcgggcgaaggcgtgttcaacatcgagcagttcgatcccgatccctacatg
gacatgctcaacaagcatggcctgccctggcaggtgaaggaactggcgggtccgctggag
ttctga

DBGET integrated database retrieval system