KEGG   Novosphingobium aromaticivorans: Saro_1791Help
Entry
Saro_1791         CDS       T00322                                 

Definition
(GenBank) conserved hypothetical transmembrane signal peptide protein
  KO
K09922  uncharacterized protein
Organism
nar  Novosphingobium aromaticivorans
Brite
KEGG Orthology (KO) [BR:nar00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Saro_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMT_6 EamA
Motif
Other DBs
NCBI-ProteinID: ABD26231
UniProt: Q2G7E2
Position
1888914..1889264
Genome map
AA seq 116 aa AA seqDB search
MNPSALYPVLLLAGSNLVMNVAWYGHLKVPNRALWIAVLASWGLAFFEYWMAVPANRIGS
RVYSLAELKTLQEVMSLSTFLIVAWVMFGSRPGLSQLAGMALIAAGAFLVYKSPLG
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgtcggccctatatccggtactcctgctggccgggtcgaatctggtgatgaac
gtggcgtggtacggtcacctgaaggtgccgaaccgcgccctgtggatcgcggtcctggca
agctgggggctggcgttcttcgaatactggatggctgtccccgccaaccgcatcggctcg
cgggtctattcgctggccgaactcaagacgcttcaggaggtgatgtcgctctcgacgttc
ctcatcgtcgcgtgggtcatgttcggcagccgaccgggcctcagccagcttgccggcatg
gcgctgatcgcggcaggcgcgtttctcgtctacaagtcgccgcttggataa

DBGET integrated database retrieval system