KEGG   Novosphingobium aromaticivorans: Saro_1794Help
Entry
Saro_1794         CDS       T00322                                 

Definition
(GenBank) Orn/DAP/Arg decarboxylase 2
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00330  Arginine and proline metabolism
nar00480  Glutathione metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Saro_1794
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Saro_1794
Enzymes [BR:nar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     Saro_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N Gag_p12 HMGL-like
Motif
Other DBs
NCBI-ProteinID: ABD26234
UniProt: Q2G7D9
Position
1891915..1893120
Genome map
AA seq 401 aa AA seqDB search
MHIHPDALAVVRASAPDQPAILNRPHAAARAARFFVEKFPGKSLYAVKANPSADLLRVLW
DSGVTHYDVASIAEVRLVRATLPEATLCFMHPVKAPAAIREAYEQHGVRVFSLDSFEELE
KIKEACGFAEDLTLCVRLRVSSDYSELSLASKFGCDLTNAAELLQATRQAADSLGVCFHV
GSQSMSPHAYVQALERVRAAIVDASVTVDIIDVGGGFPSIYPGMEPPPLEDYFGVIDRTY
ESLPISYSAELWCEPGRALCAEYNSMIVRVERRRGAELYINDGAYGALFDAAHVGWRFPV
RVLREEVANDGVEIEMEPFSFYGPTCDDMDHMEGPFELPADMKVGDYIEIGMLGAYGAAM
KTAFNGFGATEVFEVSDEPMASQYRGDRRDPRVSDNVVSLR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgcacatccatcctgacgcactggctgtagttcgcgcctcggcgccggaccaacccgcc
attctcaatcgcccgcacgccgctgcgcgcgctgcccgcttctttgtggagaagtttccg
ggcaagtcgctctatgcggtgaaggccaatccttcggccgatctgctgcgcgtcctttgg
gattcgggcgtgactcactacgatgttgcgtcgatcgcggaagtgcgcctcgtgcgcgcg
acgctgccggaagcgacgctttgcttcatgcacccggtaaaggcgcccgccgccatccgc
gaagcctacgaacagcacggcgtgcgcgtgttcagcctcgattccttcgaggaactggaa
aagatcaaggaagcctgcggctttgccgaggacctgacgctttgcgtgcgcctgcgcgtc
tcttccgattattcggaactcagccttgcatccaagttcggttgcgatctgaccaatgcc
gcggaactgctccaggcaacgcgtcaggctgcggattctctcggcgtctgcttccacgtc
ggcagccagtcgatgagcccgcatgcctatgtccaggcgctggagcgcgtgcgcgcggcc
atcgtcgacgcgtcggtcacggtcgacatcatcgatgttggcggcggctttccgtcgatc
tatccgggcatggaaccgcccccgctcgaagattacttcggcgtgatcgaccgcacctat
gaatcgttgccgatttcctactcggcggaactgtggtgcgaaccgggccgtgcgctctgc
gccgaatacaactcgatgatcgtgcgggtcgagcgccgtcgcggcgcggagctctacatc
aacgacggcgcctatggcgcgctgttcgatgccgcccacgtcggttggcgcttccccgtt
cgcgtcctgcgcgaagaggtggcgaacgacggcgtggaaatcgagatggagcccttcagc
ttctacggcccgacctgcgacgacatggaccacatggaaggtccgttcgagcttccggcc
gacatgaaggtgggcgactacatcgagatcggcatgcttggcgcttatggcgcggctatg
aagaccgcgttcaacggcttcggcgcaaccgaggtcttcgaagtctccgacgaaccgatg
gcgagccagtatcgcggcgaccgtcgcgaccctcgcgtgtcggacaacgtcgtctcgctg
cgctga

DBGET integrated database retrieval system