KEGG   Novosphingobium aromaticivorans: Saro_1798Help
Entry
Saro_1798         CDS       T00322                                 

Definition
(GenBank) beta-lactamase-like protein
Organism
nar  Novosphingobium aromaticivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: ABD26238
UniProt: Q2G7D5
Position
complement(1895894..1896814)
Genome map
AA seq 306 aa AA seqDB search
MSRFSRIVVAFLILLAAAYYWLLVNRGQPALPGRSIDIAALRKASDAMPGEKPTGLEYAI
IATRRIPGAALAAGTGLRPISSGVVVWRIVTPRGGIVIDSGLSRNDAASMGFKEYDGRAM
ALAGRWMEQAELLLFTHEHVDHVGGFLDHQPFQAVAGKAVLSPRMLQGMNALWRENARLL
PPPRLAEPVQPVAPGVVLVATPGHTPASQMIYVRLADGREYLFAGDTASLRANYEIPTPR
SRLVADWLAPEDRPVAFAWLDALKRLKARHEALVIVPSHDPDWIAATAAKAGFSRLPAPA
KTLSVN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcttttccaggatcgtcgttgctttcctcatcttgcttgcggcggcctactac
tggctcctggtcaaccgggggcaaccggccctgcccggccgcagcatcgatatcgcagct
cttcgcaaggcgtcggacgccatgccgggcgagaagccgaccggactggaatatgcgatc
atcgcaacccggcgcattcccggcgccgcactggcggcaggaacggggctcaggccaatt
tccagcggcgttgtcgtctggcgaatcgtcacgccgcgcggcggcatcgtgatcgacagc
ggcctttcgcgaaacgatgccgcctcgatgggcttcaaggaatacgacggccgcgcgatg
gcactggcgggccgctggatggagcaggccgagcttcttctgttcacgcacgagcatgtc
gaccacgtcggcggatttctcgatcaccagccattccaggccgtggcgggcaaggccgtg
ctttcgccgcgcatgctccagggcatgaatgcgctctggcgcgagaatgcgcggctgttg
cctccgccacgcttggcggagccggtccagcccgtggcgccaggcgtggtgctggtcgcc
acgccggggcatacgccggcttcccagatgatctatgtccggcttgccgatggtcgggaa
tatctgttcgccggagataccgcctcgctgcgcgccaactacgagataccgacgccgcgc
tcccggctcgtcgccgactggctggcaccagaggaccggccggttgccttcgcctggctc
gacgcgctcaagcgcctgaaggccaggcacgaggcgctggtgatagtgccctcgcatgat
cccgactggattgccgccaccgctgcgaaggccggcttcagtcgccttcccgcccccgca
aaaaccctatcagtcaattag

DBGET integrated database retrieval system