KEGG   Novosphingobium aromaticivorans: Saro_1809Help
Entry
Saro_1809         CDS       T00322                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00030  Pentose phosphate pathway
nar00500  Starch and sucrose metabolism
nar00520  Amino sugar and nucleotide sugar metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1809
   00030 Pentose phosphate pathway
    Saro_1809
   00500 Starch and sucrose metabolism
    Saro_1809
   00520 Amino sugar and nucleotide sugar metabolism
    Saro_1809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_1809
Enzymes [BR:nar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Saro_1809
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Saro_1809
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_1809
  Exosomal proteins of colorectal cancer cells
   Saro_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ABD26249
UniProt: Q2G7C4
Position
1907699..1909222
Genome map
AA seq 507 aa AA seqDB search
MTVAEAETYWTALAGLPRPTLKELFSDAGRLDRYAATLDLPGGPIRFDWSKTHLSAEVEA
VFAALASAMDFEGRRAALIEGAKINNTEGRAAEHTAQRGIGNEASVEEAEALHARMRMLV
DAIHAGALGEVRSLIHIGIGGSALGPALAIDALTRDGAKVAVHVVSNIDGCALEAAMKAC
DPATTMIAVASKTFTTTETMTNAASALEWLRENGVADPYGQVVALTAAPEKAVEWGVDET
RVLPFSETVGGRYSLWSSIGFPVAMALGWEGFAAFLDGAAAIDRHFIDADLAGNVVVRAA
FADLYYTQVRGCQTRAVFAYDERLALLPDYLQQLEMESNGKRVLADGSPLTRPSAPVTWG
GVGTDAQHAVFQLLHQGTHLIPVDFLAVKTQGHDLDPAHHQILLSNCFAQGAALMAGKAS
DDGARAYPGDRPSATILCDDLNPATLGALIAFHEHRTFVSAVMLGINPFDQFGVELGKAI
AKQIESGGGEGFDPSTEALLAAVGLAG
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgccgaagcggaaacgtactggacggcgctggccgggctgccgcgcccgacg
ctcaaggagctgttctccgatgccggccgtctcgatcgctacgccgctacgctcgacctg
ccgggcggcccgatccgcttcgactggtccaagacgcacctctccgccgaagtggaagcg
gtgttcgccgcgcttgcatcggcgatggacttcgaaggccgccgcgccgcgctgatcgag
ggcgcgaaaatcaacaacaccgaaggccgcgcggccgagcacaccgctcagcgcggcatc
ggcaacgaggccagcgtcgaggaagccgaggcgctccacgcccgcatgcgcatgctggtc
gacgcgatccacgccggtgcgcttggcgaagtgcgcagcctgatccacattggcatcggc
ggttcggcgctcgggccggcgctggcgatcgacgcactgacccgcgacggcgcgaaggtg
gccgtccacgtcgtgtcgaacatcgacggctgcgcgctcgaagccgctatgaaggcctgc
gatccggcaacgacgatgatcgccgttgcctccaagaccttcaccacgaccgagacgatg
accaacgctgcctcggcgcttgaatggctgcgcgagaacggcgttgccgatccctatggc
caggtcgttgcgctcaccgccgcgcccgagaaggcggtcgagtggggcgtcgacgaaacc
cgcgtcctgccgttctccgaaaccgtgggcgggcgttactcgctgtggtcgtcgatcggt
ttcccggtcgcgatggcgctggggtgggaaggcttcgccgcgttcctcgacggtgcggcg
gctatcgatcgccatttcatcgacgcagacctggccggcaacgtcgtcgttcgcgccgcc
tttgccgatctctattacactcaggttcgcgggtgccagacgcgtgcggtcttcgcctat
gacgaacgcctcgcgcttctgccggactatctccagcagctcgaaatggaatcaaacggc
aagcgcgtcctcgccgatggctctccacttacacggccaagcgcgccggttacctggggc
ggcgtcgggaccgatgcacagcatgccgtgttccagctcctgcaccagggtacgcacttg
attccggtcgatttccttgccgtcaagacgcagggccacgacctcgacccggcgcatcac
cagatcctgctttccaactgcttcgcccagggtgctgcgctcatggccggcaaggcgagc
gatgacggcgcgcgtgcctatcccggcgaccgtccttccgcgacgatcctgtgcgacgat
ctcaaccccgcgacgctcggcgcgctgatcgccttccacgagcatcgcacgttcgtctct
gcggtgatgctcggcatcaatcccttcgaccagttcggcgtcgaactgggcaaggccatt
gccaagcagatcgagtctggcggcggcgaaggcttcgatccgtcgaccgaagcactcctg
gcagcggttggcctcgccggctga

DBGET integrated database retrieval system