KEGG   Novosphingobium aromaticivorans: Saro_1815Help
Entry
Saro_1815         CDS       T00322                                 

Definition
(GenBank) conserved hypothetical protein 730
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00230  Purine metabolism
nar00240  Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Saro_1815
   00240 Pyrimidine metabolism
    Saro_1815
Enzymes [BR:nar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     Saro_1815
    3.2.2.-  
     Saro_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysine_decarbox DNA_processg_A
Motif
Other DBs
NCBI-ProteinID: ABD26255
UniProt: Q2G7B8
Position
complement(1914145..1914726)
Genome map
AA seq 193 aa AA seqDB search
MKRLAVYCGSASPADGRYVTLAREVGQELARRGIGVVYGGGRLGLMGAVAYGALDAGGEV
IGIIPEALVNSEVANHDCTELHVVSGMHERKKRFTDLSDGFLTIPGGVGTMDELWEAMSW
AQLGYHAKPVGLLNAFGFYDHLLAFNRHMIEVGFVREAHAGILLAEPSLDLLLARMAAHE
PHTPIFAMKADDL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgcctcgccgtctattgcggctccgcttcgcccgccgatggccgttacgtgacg
cttgcgcgcgaagtgggccaggaactggcccggcggggcatcggcgtggtctacggcggc
gggcggctgggcctgatgggagcggtggcctatggcgcgctcgacgcgggcggcgaagtg
atcgggataattcccgaagcgctggtcaacagcgaggtcgcgaaccacgactgtaccgaa
cttcacgtcgtatccggcatgcacgaacgcaagaagcggttcaccgacctgtcggacggc
ttcctgacgatcccgggcggtgtcggcacgatggacgagctgtgggaggcgatgagctgg
gcgcagctcggctatcacgcaaagccggtgggcctgctcaacgccttcggcttctacgac
cacctgctggctttcaaccgccacatgatcgaggtcggcttcgtccgcgaggcccatgcc
ggcatccttcttgccgaacccagcctcgacctgctgctggcacgcatggcggcgcacgag
ccgcacacgccgatcttcgcaatgaaggccgacgacctgtga

DBGET integrated database retrieval system