KEGG   Novosphingobium aromaticivorans: Saro_2625Help
Entry
Saro_2625         CDS       T00322                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00620  Pyruvate metabolism
nar00640  Propanoate metabolism
nar00680  Methane metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_2625
   00620 Pyruvate metabolism
    Saro_2625
   00640 Propanoate metabolism
    Saro_2625
  Energy metabolism
   00680 Methane metabolism
    Saro_2625
Enzymes [BR:nar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Saro_2625
Lipid biosynthesis proteins [BR:nar01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Saro_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABD27061
UniProt: Q2G512
Position
2840827..2842776
Genome map
AA seq 649 aa AA seqDB search
MGEAVYPVPAEWAQNALVDEARYQDMYRQSVDDPEGFWAEHGKRIDWIRPFTKVKNTSFH
EADFGIRWFEDGTLNLAANCLDRHLAERGDEIAILWEPDSPDEAHREITYRQLHADVCRF
ANLLKAKGVQKGERVTIYLPMVPEAAVAMLACARIGAIHSIVFAGFSPDALAGRITDCDS
RIVLTSDEGLRGGRKVPLKANVDEALKQCPGVDTVIMLRRTGADVDFVEGRDIDWATAVA
EQSADCQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYSVWASMTHQYVFDYRPGQIYW
CAADIGWVTGHSYVVYGPLMNGATTVMFEGVPNFPDASRFWQVVDKFKVEIFYGAPTALR
ALMREGDEWVKKTSRASLRLLGSVGEPINPEAWEWYHKVVGDSRCPIVDTWWQTETGGAM
ITPLPGATALKPGSASRPFFGVKPALVDNDGTFLEGATDGCLVVTDSWPGQMRTVWGDHE
RFFQTYFTTFKGLYFTGDGCRRDEDGYYWITGRIDDVINVSGHRMGTAEIESALVAHPKV
AEAAVVGMPHDIKGQGIYAFVTCNAEIEPDDLLRKELIQWVRHEIGPIATPDVIQFAPGL
PKTRSGKIMRRILRKIGENDVSNLGDTSTLADPSVVDNLLANRPQLAGA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggcagtctatcctgtaccggctgagtgggcgcagaacgcgctggtcgacgag
gcgcgctaccaggatatgtatcgccagtcggtcgacgatcccgaaggcttctgggccgaa
cacggcaagcggatcgattggatcaggcctttcaccaaggtcaagaacacctcgtttcac
gaagccgacttcggcatccgctggttcgaggacggcacgctcaacctcgccgcgaactgc
ctcgaccgtcacctcgccgaacgcggcgacgagatcgcgatcctgtgggagcccgacagc
cccgacgaggcacaccgcgagatcacctaccgccagctccacgccgatgtctgccgcttt
gccaacctgctgaaggccaagggcgtccagaagggcgagcgcgtcaccatctacctgccg
atggtgccggaagccgccgtggcgatgctggcctgcgcccgcatcggcgcgatccattcc
atcgtctttgcaggcttcagcccggatgcgctggccggccgcatcaccgactgcgacagc
cgcatcgtcctcacctcggacgaaggcctgcgcggcggacgcaaggttccgctgaaggcc
aatgtggacgaggcgctgaagcaatgccccggcgtcgacaccgtgatcatgctgcgccgc
acgggcgccgacgtggactttgtcgaaggccgcgacatcgactgggcaacggcagtcgcc
gagcagagcgccgattgccagcccgaggaaatgaacgcggaagacccgctgttcatcctc
tacacctccggctctaccggaaagcccaagggcgtgctgcacacgacgggcggctattcg
gtctgggcgtcgatgacgcaccagtacgtgttcgattaccgtcccgggcagatctactgg
tgcgcggccgacatcggctgggtcaccggccactcctatgtcgtctacggaccgctcatg
aacggcgccactacggtcatgtttgaaggcgtgccgaacttcccggacgcaagccgcttc
tggcaggtggtcgacaagttcaaggtcgaaatcttctacggcgcccctaccgcgctgcgc
gccctgatgcgcgagggcgacgaatgggtgaagaagacgagccgcgcctcgctgcgcctg
cttggttcggtgggcgaaccgatcaatcccgaagcctgggaatggtatcacaaggtcgta
ggcgacagtcgctgcccgatcgtcgacacctggtggcagaccgaaaccggcggggcgatg
atcaccccgctaccgggcgcgaccgcgctcaagcccggctcggcctcgcgcccgttcttc
ggcgtaaagcccgcgcttgtcgataacgacggcacgttccttgaaggcgcgactgacggg
tgcctcgtagtgaccgatagctggcccggccagatgcgcaccgtgtggggcgatcacgag
cggttcttccagacctatttcaccactttcaagggcctgtacttcaccggcgacggatgc
cgccgcgacgaggacggctactactggatcaccggccgcatcgacgacgtgatcaacgtg
tcgggccaccgcatgggaacggcggaaatcgaaagcgcgctggtcgcccacccgaaggtg
gccgaagctgcggtcgtcggcatgccgcacgacatcaagggccagggcatctacgccttc
gtcacctgcaatgccgaaatcgagcccgacgacctgctgcgcaaggagttgatccagtgg
gtccgccacgaaatcggccccatcgccacgccggacgtgatccagttcgctcccggtctg
cccaaaacccgttcgggcaagatcatgcgccgcatcctgcgcaagatcggcgagaacgac
gtctccaaccttggcgacacgtcgacccttgccgatccgtcggttgtcgataatctgctg
gccaacagaccgcagctcgcaggggcttga

DBGET integrated database retrieval system