KEGG   Novosphingobium aromaticivorans: Saro_3560Help
Entry
Saro_3560         CDS       T00322                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00020  Citrate cycle (TCA cycle)
nar00620  Pyruvate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01200  Carbon metabolism
Module
nar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_3560
   00020 Citrate cycle (TCA cycle)
    Saro_3560
   00620 Pyruvate metabolism
    Saro_3560
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Saro_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABP64420
UniProt: A4XEQ9
Position
pNL2:176934..178376
Genome map
AA seq 480 aa AA seqDB search
MANIRPFCMPKWGIEMTEGTIAEWMVKEGEAFNKGQVLCLIETAKITNEVEAEYDAVLKR
LLTPASDEAHPVGALLAVFADADTTDAEVDEFIAGFKPAETSVAAKSGGGSAPAPAPAAA
APAPAAPARTPTKIVTNRAISPEALKLAEAEGVDIEPIEGSGRNGRITYQDVVQALRPER
ALSYKGSAQLVEDSPEAFASPLARRIAAQHGIALAGIKGTGARGRISKADVMALVKPTTA
AAPVFGAPFELVANQPQVQPFDKVRKVVARRLTEAKQTIPHFYLRVSASVDALMDLRKTA
NLVLGTKASINDYLVKAVALALVRHPDVNVQVHGDSVHSFPHADVAIAVASPKGLVTPIV
RQADRMHIAQIAATTRALIDKAQAGRLGYEDMDGGTFSVSNLGMFGIEQFDAIINPPQGA
ILAVGGVNRVAVEAANGDIAFENRIQLTMSVDHRAIDGAAGAKFLQTLKGLLEAPEGLFA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggccaatatccgcccgttctgcatgcccaagtggggcatcgaaatgaccgagggcacc
atcgccgaatggatggtcaaggaaggcgaggccttcaacaagggtcaggtcctctgcctg
atcgagaccgccaagatcaccaacgaggtggaagcggaatacgacgcggtcctgaagcgc
ctgctgacgcctgcgagcgacgaggcccaccccgtgggcgcgctgctggcggtctttgcc
gatgccgacacgaccgacgccgaggtcgatgagttcatcgccggcttcaagcccgccgag
acctcggttgcggccaagagcggcggcggttcggccccggcccccgccccggctgcggcg
gcgcctgctccggcggctcccgcgcgcacgccgacgaagatcgtcaccaaccgcgcaatc
agccccgaggcattgaagctggccgaggccgaaggcgtcgacatcgaacccatcgaaggt
tcgggccgcaatggccggatcacctaccaggatgtggttcaggccctgcgcccggagcgc
gccttgtcatacaagggcagcgcgcagctggtggaggacagccccgaggccttcgcgtcg
ccgctggcccgccgcatcgcggcccagcacggcatagcgctggccgggatcaagggcacc
ggcgcgcgcggccgtatctcgaaagcggacgtgatggcgctggtcaagccgaccacggcc
gcggcaccggtcttcggcgcgccgttcgaactggttgccaaccagccgcaggtccagccg
ttcgacaaggtacgcaaggtcgtcgcgcgccgcctgaccgaggcgaagcagacgatcccg
cacttctacctgcgcgtctcggcctcggtcgacgcgctgatggacttgcgcaagacggcc
aacctcgtgctcggcaccaaggcttcgatcaacgactacctggtcaaggccgtggcgctg
gcgctggtgcggcatcccgacgtcaacgtgcaggtccatggcgacagcgtccacagcttc
ccccacgccgatgtcgccatcgcggttgccagccccaagggcctggtcaccccgatcgtg
cgacaggcggatcgcatgcacatcgcgcagatcgcggccactacccgcgcactgatcgac
aaggcacaggcgggccggctcggctatgaggacatggacggcgggaccttctcggtgtcg
aacctcggcatgttcgggatcgagcagttcgatgcgatcatcaacccgccgcagggcgcg
atccttgcggtcggcggggtgaaccgcgtggcggtggaagcggcgaacggcgacatcgct
ttcgaaaaccgcatccagctgaccatgtcggtcgatcatcgcgcaatcgatggcgctgcg
ggcgcgaagttcctgcagacgctcaagggcctgctcgaagcgccggaaggactgttcgca
tga

DBGET integrated database retrieval system