KEGG   Novosphingobium aromaticivorans: Saro_3688Help
Entry
Saro_3688         CDS       T00322                                 

Definition
(GenBank) Semialdehyde dehydrogenase, NAD - binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00360  Phenylalanine metabolism
nar00362  Benzoate degradation
nar00620  Pyruvate metabolism
nar00621  Dioxin degradation
nar00622  Xylene degradation
nar00650  Butanoate metabolism
nar01100  Metabolic pathways
nar01120  Microbial metabolism in diverse environments
nar01220  Degradation of aromatic compounds
Module
nar_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:nar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_3688
   00650 Butanoate metabolism
    Saro_3688
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Saro_3688
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_3688
   00622 Xylene degradation
    Saro_3688
   00621 Dioxin degradation
    Saro_3688
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Saro_3688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ABP64547
UniProt: A4XF36
Position
pNL2:complement(322619..323554)
Genome map
AA seq 311 aa AA seqDB search
MTRVKAAIIGSGNIGTDLMMKMIKYPQNMELAIVVGIDEKSEGLAMAREHGIATTHEGLE
GLRRHPLYKEIGIAFDATSAYAHKVHDEALRADGIQVVDLTPAAIGPFTVPPVNMSQHLD
QPNVNMVTCGGQATIPMVAAVARVSDKVHYAEIVASVSSRSAGPGTRANIDEFTRTTARA
IEVVGGATRGKAIIILNPAEPPMIMRDTVFTLSEGADEDQIRRSVADMVAEVQKYVPGYR
LKQEVQFERFGDNNKLKIPGQGEFTGIKSMIMLEVEGAGDYLPSYSGNLDIMTAAAKATG
ELLAARRMAAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgtgaaggccgcgatcatcggttcgggcaatatcggcaccgacctgatgatg
aagatgatcaagtacccgcagaacatggagctggccatcgtcgtcggtatcgacgagaag
tcggaaggcctcgcgatggcccgcgaacacggcatcgcaacgacacacgaaggcctcgaa
ggcctgcgtcgccatccgctctacaaggagatcggcatcgccttcgacgcgaccagcgca
tatgcccacaaggtccacgacgaagccctgcgcgccgacggcatccaggtcgtcgacctg
acgcccgcagccatcggccccttcactgtgccgccggtcaacatgagccagcatctcgac
cagcccaacgtgaacatggtcacctgcggcggccaggcgacgatcccgatggtcgccgcc
gtcgcccgcgtgtcggacaaggttcactacgccgagatcgtcgcttcggtctcctcgcgt
tcggcgggccccggcacgcgcgccaacatcgacgagttcacccgcaccaccgcccgcgcg
atcgaagtcgtcggcggcgcgacgcgcggcaaggcgatcatcatcctcaacccggccgaa
ccgccgatgatcatgcgcgacacggtgttcaccctgtccgaaggcgctgacgaggaccag
atccgccgctcggtcgccgacatggttgccgaagtgcagaagtacgtgcccggctaccgg
ctcaagcaggaagtccagttcgaacgcttcggcgacaacaacaagctgaagatccccggc
cagggcgaattcaccggcatcaagtcgatgatcatgctcgaggtcgagggcgccggcgac
tacctgcccagctattccggcaacctcgacatcatgaccgccgccgccaaggccaccggc
gagcttctcgctgcgcgccgcatggccgccgcctga

DBGET integrated database retrieval system