KEGG   Novosphingobium aromaticivorans: Saro_3766Help
Entry
Saro_3766         CDS       T00322                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00072  Synthesis and degradation of ketone bodies
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00640  Propanoate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01130  Biosynthesis of antibiotics
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_3766
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_3766
   00640 Propanoate metabolism
    Saro_3766
   00650 Butanoate metabolism
    Saro_3766
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_3766
   00072 Synthesis and degradation of ketone bodies
    Saro_3766
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_3766
   00310 Lysine degradation
    Saro_3766
   00380 Tryptophan metabolism
    Saro_3766
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_3766
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_3766
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_3766
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_3766
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_3766
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_3766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABP64625
UniProt: A4XFB4
Position
pNL2:403133..404335
Genome map
AA seq 400 aa AA seqDB search
MREAAIVSTARTGVGKAYRGAFNDTEAPVLSSHVVNAAIERAGIDPARVDDVYLGVGNHW
NTQSYNLGRLTVHGSVLPDTTAGFTLDRKCSSGLNAIALAARGIMCNEIDVAVAGGMESI
SLTINKHAPAFRNRSEFIKAADPHAYMVMIETAEIVAERYGVSREDQDRFAALSQQRAAA
AQEAGRFDDEIVPITVTKALFDKEGNETGKEQVTLDRDEGVRAGTTYEALAGLKPVFKGG
QVIAEGRHVTAGNASQLSDGASAQVLMDLDTARAEGRPVLGIYRGFQVAGCGAEEMGIGP
VFAIPKLLDRAGLKVEDIGLFEINEAFASQAVYCQQKLDIDPERLNVNGGGIAIGHPFGM
TGSRLVGHALIEGRRRGVKYAVVSMCVAGGMGAAGLFEVA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagccgccatcgtttcgaccgcccgcactggcgtgggcaaggcctaccgcggt
gccttcaatgacaccgaggcccctgtcctttcctcgcacgtggtcaatgccgcgatcgag
cgtgcgggcattgacccggcgcgggtcgacgacgtttacctcggcgtcggcaaccactgg
aacacgcagagctacaacctcggtcggttgaccgtgcacggttcggtcctgcccgacacg
accgccggcttcactctggaccgcaagtgctcatccgggctcaacgccatcgcgctggcc
gcgcgggggatcatgtgcaacgagatcgacgttgcggtggccgggggcatggaaagcatc
tcgctgaccatcaacaagcacgcgcccgccttccgcaaccggtccgaattcatcaaggcg
gcggacccgcacgcctacatggtgatgatcgagaccgccgagatcgtggccgagcgctat
ggcgtgagccgcgaggatcaggaccgattcgctgcactgtcgcagcagcgcgcggcggcc
gcgcaggaggcgggccggttcgacgacgaaatcgtgcctatcacggtgacgaaggcgctg
ttcgacaaggaaggcaacgagaccggcaaggaacaggtcacactggaccgcgacgagggc
gtgcgcgcgggcacgacctatgaggctcttgctggcctgaagccggtgttcaagggtggt
caggtcattgcagagggccgccatgtcactgccgggaacgcctcgcagctttccgatggc
gcttcggcgcaggtactgatggatctcgacactgcgcgtgccgaaggacgtccagtgctg
ggcatctatcgcgggttccaggtcgctggttgcggcgccgaggaaatgggcattggcccg
gtcttcgccatccccaagctgctcgaccgcgcggggcttaaggtcgaggacatcggtctg
ttcgaaatcaacgaggctttcgcttcgcaggcggtctattgccagcagaagctggatatc
gaccccgaaaggctcaacgtgaatggcggcggaatcgccattggccatccgttcgggatg
accggttcgcgccttgtcggccatgcgctgatcgagggcaggcgccgcggcgtgaagtac
gccgtcgtgtcgatgtgcgtggcgggtggcatgggcgccgccggcctgttcgaagtggcc
tga

DBGET integrated database retrieval system