KEGG   Novosphingobium aromaticivorans: Saro_3836
Entry
Saro_3836         CDS       T00322                                 

Definition
(GenBank) dihydrodipicolinate synthetase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00626  Naphthalene degradation
nar01100  Metabolic pathways
nar01120  Microbial metabolism in diverse environments
nar01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Saro_3836
Enzymes [BR:nar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     Saro_3836
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ABP64082
UniProt: A4XDS1
Position
pNL1:complement(2809..3795)
AA seq 328 aa
MARELLTAADVKGAWAIVPTPAKEGASDWRAADTVNVEEAARMIDGLIEAGVDGILSMGT
LGEAATMTLDEKLVFMKTIVDTAAGRVPVFVGTTCINTRDTIALTRKAVDIGATGTMLGV
PMWCAPSVDVAVQFYRDVAEAVPDINIAIYANPEAFKFDFPRTFWGQVAEIPQVVTAKYI
GVGTLLPDLAAIKGRIKLLPIDFDYYGAARMDDSIDAFWTSGAVCHPLVSTTLRDVVAAA
RASGDWSAAKAFMGRLAPTAATLFPNGSFKEFSTYNIPLEKARMTAGGWMNAGPCRPPYH
LCPENYLEGARNSGRMWAELGKALEAER
NT seq 987 nt   +upstreamnt  +downstreamnt
gtggcgcgtgaactgctgactgctgctgatgtgaagggtgcttgggcgatcgtgccgact
ccagccaaggaaggtgcctccgactggcgcgccgctgatactgttaatgtcgaagaagca
gcccgcatgatcgacggcctgatcgaggccggggtcgatggcattctcagtatggggacg
ctgggcgaggccgcaaccatgacacttgacgaaaagctcgtctttatgaagactatcgtc
gataccgccgcgggccgggtgccggtgtttgtcgggacaacctgcatcaacacccgcgac
accattgcgctaacccgcaaggcagtcgatatcggcgcgaccgggacgatgttgggcgta
ccgatgtggtgcgcccccagtgtcgacgtcgcggtacagttctatcgcgacgttgccgag
gcggtgcccgacatcaacatcgcgatctatgccaaccccgaagccttcaagttcgatttc
ccgcgcacgttctggggccaggtcgccgaaattccgcaggttgtcaccgccaagtacatc
ggcgtcggcaccctgctgcccgatctcgcggcgatcaaggggcggatcaagctgctgccg
atcgatttcgattactacggcgcggcgcggatggacgattcgatcgacgccttctggacc
agcggcgcggtctgccacccgctggtcagcacgaccctgcgcgatgtggtcgccgcagcg
cgcgcgagcggcgactggagcgctgccaaggctttcatgggccggctcgcgccgactgcg
gcgacgcttttcccgaacggcagcttcaaggaattctcgacctacaacatccccctggaa
aaggcgcggatgaccgccggcggctggatgaatgccgggccttgccgtccgccctatcac
ctgtgtcccgaaaactatctcgaaggcgcgcgcaattcaggcaggatgtgggctgaactg
ggcaaggcgctcgaggcagagcgttga

DBGET integrated database retrieval system