KEGG   Natrinema sp. J7-2: NJ7G_0220Help
Entry
NJ7G_0220         CDS       T02184                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00010  Glycolysis / Gluconeogenesis
nat01100  Metabolic pathways
nat01110  Biosynthesis of secondary metabolites
nat01120  Microbial metabolism in diverse environments
nat01130  Biosynthesis of antibiotics
nat01200  Carbon metabolism
nat01230  Biosynthesis of amino acids
Module
nat_M00002  Glycolysis, core module involving three-carbon compounds
nat_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_0220
Enzymes [BR:nat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     NJ7G_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C TrkA_N Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFO55475
UniProt: I7BRV8
Position
213126..214142
Genome map
AA seq 338 aa AA seqDB search
MQQVAINGYGTIGKRVADAVRQQPDMEVLGVAKTRPNFEAETAIDKGFPLYAAVEEREEL
FAEAGLEIAGPVEDLVAEADVVVDATPSGIGAQNKALYEEYDTPALYQGGEDADLVDVSF
NARSNFEDAVDADHVRVVSCNTTGLSRVIAPLREEYGVEKVRATLVRRGGDPGQSDRGPI
NDILPNPVTIPSHHGPDVETIFPDLDIDTLGMKVPATLMHMHSLNITLEEDVDAAAVRDL
FADESRLFLIPERMDIDGSGKLKEYALDAGRPRGDLWENCLWAESISTEGRDFYCFQGIH
QESDVVPENVDAIRAVTGAADAEESIATTDEALGIGLR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggtcgccatcaacggctacggcacgatcggcaagcgcgtcgcggacgcagtc
cggcaacagcccgacatggaagtactgggcgtcgccaagacgcgcccgaacttcgaggcc
gagacagcgatcgacaaggggttcccgctctacgcggccgtcgaagaacgcgaggagttg
ttcgccgaggccggcctcgagatcgcagggccggtcgaggacctcgtggccgaggccgac
gtcgtcgtcgacgccacgccgtcggggatcggtgcgcagaacaaggccctctacgaggag
tacgacacgcccgcgctctatcagggcggcgaggacgccgacctcgtcgacgtgagtttc
aacgcgcgctcgaacttcgaagacgccgtcgacgccgaccacgtgcgcgtcgtctcctgt
aacacgaccggactctctcgggtcatcgcccccctgcgcgaggagtacggcgtcgagaag
gtccgtgcgacgctcgtccgtcgcggcggcgatcccgggcagtccgatcgtggtccgatc
aacgacatcctcccgaacccggtgacgatcccgtcacaccacggcccggacgtcgagacc
atcttccccgacctggacatcgacacgctcgggatgaaggtgcccgcgacgctgatgcat
atgcacagtctgaacatcaccctggaggaggacgtcgacgctgcggccgtccgtgacctg
ttcgccgacgagtcgcgcctgttcctgatccccgagcgcatggacatcgacggcagcggc
aaactcaaggagtatgcactggacgccggccgcccccgcggcgacctctgggagaactgt
ctctgggcggagtccatctcgaccgagggccgggacttctactgcttccagggcatccac
caggagagcgacgtcgtgccggagaacgtcgacgccatccgcgccgtgaccggcgctgcc
gacgccgaggagagcatcgcaacgaccgacgaggcgctcggtatcggcctccgatag

DBGET integrated database retrieval system