KEGG   Natrinema sp. J7-2: NJ7G_0552Help
Entry
NJ7G_0552         CDS       T02184                                 

Definition
(GenBank) phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00010  Glycolysis / Gluconeogenesis
nat00030  Pentose phosphate pathway
nat00051  Fructose and mannose metabolism
nat00052  Galactose metabolism
nat00230  Purine metabolism
nat00500  Starch and sucrose metabolism
nat00520  Amino sugar and nucleotide sugar metabolism
nat00521  Streptomycin biosynthesis
nat01100  Metabolic pathways
nat01110  Biosynthesis of secondary metabolites
nat01120  Microbial metabolism in diverse environments
nat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NJ7G_0552
   00030 Pentose phosphate pathway
    NJ7G_0552
   00051 Fructose and mannose metabolism
    NJ7G_0552
   00052 Galactose metabolism
    NJ7G_0552
   00500 Starch and sucrose metabolism
    NJ7G_0552
   00520 Amino sugar and nucleotide sugar metabolism
    NJ7G_0552
  Nucleotide metabolism
   00230 Purine metabolism
    NJ7G_0552
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NJ7G_0552
Enzymes [BR:nat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NJ7G_0552
    5.4.2.8  phosphomannomutase
     NJ7G_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFO55807
UniProt: I7BHQ3
Position
507218..508594
Genome map
AA seq 458 aa AA seqDB search
MQVFGSSGTRGVANEELTPAFVLRVAKAAGTTWGDGHGGDRVAIARDTRHTGRMLADAAA
SGMASTGTDVDRLGIVPTPGAQAYAEREGVPVIVITASHNPPPYNGVKLVGADGVELSIA
DLESIEETLLAESFTVAPWNETGRVREIDGVTQAYVDELLAAADRDRIADADLTVALDPG
HGAGSLTSPEFFRKLGCRVVTVNAQPDGHFPGRDPEPVPDNLTDLGRLVRATDADIGIAH
DGDADRAIFFDETGAYVEGDATLAALAAAELEAGDTTVSAVNVSQRLVDVVTEVGADLEL
TPIGSTNIITRIEELEENGERVPVAGEGNGGIFFPDYRLSRDGAFTAARFLELVAERPVS
EIVAPYGGYVNVRHNVEYESTAERDAMLDAAANQAQAADADLNTRDGYRLDYGDAWVLAR
PSGTEPLVRIYAEARDGDRAEELASDMHDALAAAKADI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcttcggatcgagtgggacgcggggcgtcgccaacgaggagttgacgcccgcg
ttcgtcttgcgcgtcgcgaaagcggcggggacgacttggggagacgggcacggtggggac
cgagtggccatcgcccgcgacactcgccataccgggcggatgctggccgacgcggccgcg
agcgggatggcgagtaccggtaccgatgtcgaccgcctcggaatcgtcccgacgccaggc
gcacaagcctacgccgaacgggaaggcgtcccagtaatcgtcatcacggcctcgcacaac
ccgccgccgtacaacggcgtcaaactcgtcggtgccgatggcgtggagctctcgatcgcc
gacctcgagtccatcgaggagacactgctcgccgaatcgttcaccgtcgccccctggaac
gagaccggccgcgttcgcgagatcgacggcgtgacgcaggcgtacgtcgacgaactgctc
gcggccgccgatcgcgaccggatcgccgacgccgacctcaccgtcgcgctcgatccgggt
cacggcgcgggatcgctgaccagccccgagttcttccggaaactcggttgtcgagtggtc
acggtcaacgcccagcccgacggccacttcccgggtcgggaccccgagccggtccccgac
aacctcaccgatctcggccgcctcgtccgtgcgaccgacgccgacatcggcatcgctcac
gacggcgacgccgatcgcgccattttcttcgacgagaccggcgcgtacgtcgagggcgat
gccacgctcgccgcgctcgcagccgccgaactcgaggccggcgacaccaccgtctcggcg
gtcaacgtctcccagcgactcgtcgatgtcgtcaccgaggtcggggccgacctcgagttg
accccgatcggctcgacgaacatcatcacccggatcgaggaactcgaggaaaacggcgag
cgggtgcccgtcgcgggcgagggcaacggcgggatcttcttccccgattaccggctctcg
cgagacggtgccttcacggccgcgcgcttcctcgagttggttgccgagcgacccgtcagc
gagatcgtcgcgccctacggcggctacgtcaacgtccgccacaacgtcgagtacgaatcg
acggccgagcgcgacgcgatgctcgacgcggcggccaatcaggcccaggccgccgacgcg
gacctcaacacgcgtgacggctaccggctggattacggcgacgcgtgggtgcttgcccgc
ccgtccggaaccgaaccgctcgtccggatctacgctgaggcccgcgacggtgaccgcgcc
gaggaactcgccagtgacatgcacgatgcgctggccgccgcgaaggccgacatctga

DBGET integrated database retrieval system