KEGG   Natrinema sp. J7-2: NJ7G_1456Help
Entry
NJ7G_1456         CDS       T02184                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
nat  Natrinema sp. J7-2
Pathway
nat00430  Taurine and hypotaurine metabolism
nat00460  Cyanoamino acid metabolism
nat00480  Glutathione metabolism
nat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NJ7G_1456
   00460 Cyanoamino acid metabolism
    NJ7G_1456
   00480 Glutathione metabolism
    NJ7G_1456
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nat01002]
    NJ7G_1456
Enzymes [BR:nat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NJ7G_1456
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     NJ7G_1456
Peptidases and inhibitors [BR:nat01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NJ7G_1456
CD molecules [BR:nat04090]
 Proteins
  NJ7G_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AFO56702
UniProt: I7BK21
Position
complement(1299534..1301408)
Genome map
AA seq 624 aa AA seqDB search
MTNRIGGNEGDGNTSRSSEPPGLERRAFLASAGTAAGALGIGTRSVAASDGRSTLDARGV
RCAHPQVTCGRQVTAADGMVSSVDPIASGVAAGVLREGGTAVDAAVALQYVLTVTQPHGS
GIGGGGFMVIYDADADEVDVIDSRERAPRGATADMFLDEDGDPIPFADRIRLGEAVGVPG
TVMGLETALDRHGTRPRQRLLTPAIDLAADGFPIDAVFATQIAENWEKFNDAAKAAYSDA
NGRPLTEGDTHVNTDLAETLAAIERDGAEAFYEGPIAADLAATVRDAGGSMTTDDLAAYD
VTIDDPVRAEWNGVEIVGQPLPSSGPSTVAAILKLLAFLDIGQYDRRSPAMYHLISEATS
LAWADRNEYMGAPEFVDVPIDGLLSDAYLEERAALVRTGESLADYEAGECVAPGTPSGVA
PTRGPSPDRKRGSTTHFSVVDADGNAVSYTSTIEQLMGSGLLVPGRGFMLNNELTDFNAV
PEGPNRVAPWKRPLSSMSPIIVLRDGVPEFTVGSPGGWTIITSVAQTLLHRYVYGLEPLA
ALSEPTVFTTECPPIMWEDGVPARAREATSRFGQVWSDASSGDFGNVQVIEIGDDELRGA
ADPTRDGRAVGIDRGRTRRHGRGG
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccggatcggtgggaacgaaggcgacgggaacacgtcacggtcgagcgagccg
ccgggactcgagcgacgcgcgtttctggcgagcgccggaacggccgccggtgcgctcggc
atcggcacacgctccgtcgcggcgagtgacggacggtcgaccctcgacgcccgcggagtc
aggtgtgcgcacccgcaggtcacgtgtgggcggcaggtgaccgcggccgacggcatggtc
tcgagcgtcgatccgatcgcctccggcgtcgccgcgggcgtgctgcgcgaggggggcacc
gccgtcgatgccgccgtggcgttgcagtacgtcctgacggtcacccagcctcacggctcg
gggatcggcggcggcgggttcatggtgatctacgacgccgacgcggacgaggtcgacgtc
atcgacagccgcgagcgcgcacctcggggtgcgaccgcggacatgttcctcgacgaggac
ggcgacccgatccccttcgcggaccgaatccggctgggcgaggccgtgggcgttccgggg
accgtgatgggactggaaaccgcactggatcgacacgggacgcgaccccgccagcggctg
ctcacccccgcaatcgacctcgcagctgacggctttccgatcgatgcggtcttcgccaca
cagatcgcggagaactgggagaagttcaacgacgcggcgaaggcggcctactcggatgcg
aacgggcggcccctcacggagggcgacacgcacgtcaacaccgacctcgccgagacgctc
gcggcgatcgagcgagacggggccgaggccttctacgagggccccatcgcggctgatctc
gccgcgacggtccgggacgccggcggcagcatgaccaccgacgatctcgcggcctacgac
gtcacgatcgacgacccggtccgcgccgagtggaacggcgtcgagatcgtcggccaaccg
ctcccgagttcgggcccgagcaccgtggcggccatcctgaaactgctcgcgttcctcgac
atcggacagtacgacagacgatcgccagcgatgtatcacctgatcagcgaggcgacgagc
ctggcctgggccgaccgaaacgagtacatgggcgctcccgagttcgtggacgttccgatc
gacggcctgctctccgacgcgtatctcgaggagcgcgcggcgctcgtccgaaccggagaa
tcgctcgcggactacgaggcaggggagtgcgtcgctcccggcaccccgtccggcgtcgct
ccgacgcgggggccgtcacccgatcggaagcgcgggtcgacgactcacttctccgtcgtc
gacgccgacggaaacgccgtctcgtacacgtcgaccatcgagcagctcatggggtcgggg
ctgctggtccccggccgcggcttcatgctcaacaacgaactgacggatttcaacgccgtt
cccgagggaccgaacagggtcgcgccgtggaagcggccgctgagcagcatgagccccatc
atcgtcctgcgcgacggcgtccccgagttcaccgtgggctcgccgggcggctggacgatc
atcacttcggtcgcacagacgcttcttcaccgctacgtctacggactcgagccgctcgcg
gccctctccgaaccgaccgtgttcactacggagtgcccgccgatcatgtgggaagacggc
gtcccagcgcgcgcccgcgaggcgacgagccggttcggacaggtctggagcgacgcgtcc
agcggagacttcggcaacgtccaggtgatcgaaatcggcgacgacgaactgcgcggcgcg
gccgatccgacgcgcgacgggcgggccgtcggaatcgaccgcggccggacgcggcgtcac
ggacggggcgggtaa

DBGET integrated database retrieval system